Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C357423-10 10 µg $318 
LS-C357423-100 100 µg (0.5 mg/ml) $470 
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Human Intestinal Cancer Tissue.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Rat Intestine Tissue.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Mouse Intestine Tissue.
HIF1A / HIF1 Alpha Antibody - Western blot analysis of HIF-1-alpha/HIF1A using anti-HIF-1-alpha/HIF1A antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human PC-3 whole cell lysates, Lane 2: human Caco-2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HIF-1-alpha/HIF1A antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HIF-1-alpha/HIF1A at approximately 115-120KD. The expected band size for HIF-1-alpha/HIF1A is at 97KD.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody Western blot. All lanes: Anti HIF 1 alpha at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: SHG Whole Cell Lysate at 40 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 93 kD. Observed band size: 120 kD.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody Western blot. All lanes: Anti HIF 1 alpha at 0.5 ug/ml. WB: Recombinant Human HIF 1 alpha Protein 0.5ng. Predicted band size: 36 kD. Observed band size: 36 kD.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Human Intestinal Cancer Tissue.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Rat Intestine Tissue.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody IHC-paraffin: Mouse Intestine Tissue.
HIF1A / HIF1 Alpha Antibody - Western blot analysis of HIF-1-alpha/HIF1A using anti-HIF-1-alpha/HIF1A antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human PC-3 whole cell lysates, Lane 2: human Caco-2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HIF-1-alpha/HIF1A antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HIF-1-alpha/HIF1A at approximately 115-120KD. The expected band size for HIF-1-alpha/HIF1A is at 97KD.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody Western blot. All lanes: Anti HIF 1 alpha at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: SHG Whole Cell Lysate at 40 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 93 kD. Observed band size: 120 kD.
HIF1A / HIF1 Alpha Antibody - HIF 1 alpha antibody Western blot. All lanes: Anti HIF 1 alpha at 0.5 ug/ml. WB: Recombinant Human HIF 1 alpha Protein 0.5ng. Predicted band size: 36 kD. Observed band size: 36 kD.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human HIF1A / HIF1 Alpha Antibody (aa703‑732, IHC, WB) LS‑C357423

Polyclonal Rabbit anti‑Human HIF1A / HIF1 Alpha Antibody (aa703‑732, IHC, WB) LS‑C357423

Note: This antibody replaces LS-C388586
Antibody:
HIF1A / HIF1 Alpha Rabbit anti-Human Polyclonal (aa703-732) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C357423-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
HIF1A / HIF1 Alpha Rabbit anti-Human Polyclonal (aa703-732) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
HIF1 Alpha antibody LS-C357423 is an unconjugated rabbit polyclonal antibody to HIF1 Alpha (HIF1A) (aa703-732) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human HIF1A / HIF1 Alpha
Synonyms
HIF1A | ARNT-interacting protein | ARNT interacting protein | BHLHe78 | HIF1 Alpha | Hypoxia-inducible factor1alpha | HIF-1A | HIF1 | MOP1 | Member of PAS superfamily 1 | PASD8 | HIF-1-alpha | HIF-1alpha | HIF1-ALPHA | Member of PAS protein 1
Host
Rabbit
Reactivity
Human, Chimpanzee, Orangutan, Gibbon, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human HIF-1-alpha (703-732 aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
Epitope
aa703-732
Specificity
Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. A higher level expression seen in pituitary tumors as compared to the pituitary gland. .
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HIF1A / HIF1 Alpha
Q16665 NM_001530 NP_001521.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/26/2024