LSBio The Immunohistochemistry Antibody Company
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart
Antibodies
Antibodies

We have a collection of 394,525 monoclonal and polyclonal antibodies to most target proteins. They cover all major research species, applications, and are available in multiple conjugated forms. Our IHC-plus™ antibodies are highly characterized for use in FFPE human tissue Immunohistochemistry.

ELISA Kits
ELISA Kits

ELISA Kits are a fast, cost effective way to measure the presence of specific protein or molecular analytes in a variety of sample types, such as urine, cell lysates, and in vitro. We offer multiple types of immunoassays, covering 1000's of analytes, in order to meet your specific needs.

Proteins
Proteins

Proteins can be used in a wide variety of applications, such as for the development of functional assays, small-molecule screening, receptor activation in-situ, or simply as controls for a Western Blot. We offer extracted native proteins and recombinant proteins in the form of cell lysates, or purified from bacterial or mammalian expression systems. Many proteins are bio-active and certified low-endotoxin.

Immunohistochemistry
Immunohistochemistry

Over the past 20 years we've conducted 1000's of custom IHC studies. Our staff of pathologists are experienced in designing effective IHC studies and interpreting the results in relation to normal and disease processes. These services are supported by our massive tissue bank that contains virtually every tissue type and disease.

Guarantee
Contact Us
Rewards
Most Popular Antibodies
Anti-Collagen III Antibody IHC-plus™ LS-B693

LS-B693 is a rabbit anti-Collagen III polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin, Immunoprecipitation and Western blot.

About Collagen III: Type-III Collagen is a fibrous scleroprotein in bone, cartilage, tendon, bone marrow stroma and other connective tissue. Mutations Collagen III are associated with type III and IV Ehlers-Danlos syndrome and with aortic and arterial aneurysms. (more)

Immunohistochemistry Image
Anti-BRD7 Antibody (C-Terminus) IHC-plus™ LS-B925

LS-B925 is a rabbit anti-BRD7 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About BRD7: Acts both as coactivator and as corepressor. May play a role in chromatin remodeling. Activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. Induces dephosphorylation of GSK3B at 'Tyr-216'. Down-regulates TRIM24-mediated activation of transcriptional activation by AR (By similarity). Transcriptional corepressor that down-regulates the expression of target genes. Binds to target promoters, leading to increased histone H3 acetylation at 'Lys-9' (H3K9ac). Binds to the ESR1 promoter. Recruits BRCA1 and POU2F1 to the ESR1 promoter. Coactivator for TP53-mediated activation of transcription of a set of target genes. Required for TP53-mediated cell-cycle arrest in response to oncogene activation. (more)

Immunohistochemistry Image
Anti-CACNG1 / CACNG Antibody (aa66-115) IHC-plus™ LS-B928

LS-B928 is a rabbit anti-CACNG1 / CACNG polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About CACNG1 / CACNG: Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). (more)

Immunohistochemistry Image
Anti-CDKN2A / p16INK4a Antibody (N-Terminus) IHC-plus™ LS-B1347

LS-B1347 is a rabbit anti-CDKN2A / p16INK4a polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About CDKN2A / p16INK4a: Capable of inducing cell cycle arrest in G1 and G2 phases. Acts as a tumor suppressor. Binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis in a p53-independent manner by preventing the activation of cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulates BCL6-induced transcriptional repression. Binds to E2F1 and MYC and blocks their transcriptional activator activity but has no effect on MYC transcriptional repression. Binds to TOP1/TOPOI and stimulates its activity. (more)

Immunohistochemistry Image
Anti-IL21 Antibody (Internal) IHC-plus™ LS-B1364

LS-B1364 is a rabbit anti-IL21 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About IL21: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. (more)

Immunohistochemistry Image
Anti-KRT19 / CK19 / Cytokeratin 19 Antibody (Internal) IHC-plus™ LS-B1925

LS-B1925 is a rabbit anti-KRT19 / CK19 / Cytokeratin 19 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About KRT19 / CK19 / Cytokeratin 19: KRT19 / CK19 / Cytokeratin 19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. (more)

Immunohistochemistry Image
Anti-MAP2 Antibody LS-C61805

LS-C61805 is a chicken anti-MAP2 polyclonal antibody approved for use in Immunofluorescence and Western blot.

About MAP2: MAP2 is a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. (more)

Immunofluorescence Image
Anti-LAG3 Antibody (aa70-99, clone 17B4, FITC) IHC-plus™ LS-B2237

LS-B2237 is a Fluorescein mouse anti-LAG3 monoclonal antibody approved for use in Flow Cytometry and Immunohistochemistry - Paraffin.

About LAG3: Lymphocyte-Activation Protein 3 (LAG3) belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. (more)

Immunohistochemistry Image
Anti-HPSE / Heparanase Antibody IHC-plus™ LS-B2441

LS-B2441 is a rabbit anti-HPSE / Heparanase polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About HPSE / Heparanase: Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. (more)

Immunohistochemistry Image
Anti-F8 / FVIII / Factor VIII Antibody IHC-plus™ LS-B2979

LS-B2979 is a sheep anti-F8 / FVIII / Factor VIII polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Gel shift and Immunohistochemistry - Paraffin.

About F8 / FVIII / Factor VIII: F8 / FVIII / Factor VIII is coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. (more)

Immunohistochemistry Image
Anti-CXCL1 / GRO Alpha Antibody (Biotin) LS-C104777

LS-C104777 is a Biotin rabbit anti-CXCL1 / GRO Alpha polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Neutralization and Western blot.

About CXCL1 / GRO Alpha: GRO Alpha (CXCL1), a small cytokine belonging to the CXC chemokine family, secreted by human melanoma cells, has mitogenic properties and is implicated in melanoma pathogenesis. GRO alpha is expressed by macrophages, neutrophils and epithelial cells, and has neutrophil chemoattractant activity. GRO Alpha plays a role in spinal cord development by inhibiting the migration of oligodendrocyte precursors and is involved in the processes of angiogenesis, inflammation, wound healing, and tumorigenesis. This chemokine elicits its effects by signaling through the chemokine receptor CXCR2. An initial study in mice showed evidence that GRO alpha decreased the severity of multiple sclerosis and may offer a neuro-protective function. (more)

Western blot Image
Anti-TNFRSF6B / DCR3 Antibody (clone 7G5) LS-C133572

LS-C133572 is a mouse anti-TNFRSF6B / DCR3 monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About TNFRSF6B / DCR3: Apoptosis is induced by certain cytokines including TNF and Fas ligand in the TNF family through their death domain containing receptors. Several novel members in the TNFR family including DR3, DR4, DR5, and DR6 were recently discovered and function as cell death receptors. Two decoy receptors, DcR1 and DcR2, were recently identified to compete with DR4 and DR5 for their ligand TRAIL binding. A novel decoy receptor was more recently discovered and designated DcR3 and TR6, respectively. Unlike DcR1 and DcR2, DcR3 is a soluble rather than a membrane associated molecule. DcR3 binds to FasL and LIGHT and inhibits FasL and LIGHT induced apoptosis. DcR3 transcript is expressed in a number of lung and colon carcinomas and in some normal tissues. (more)

Immunohistochemistry Image
Anti-TNFSF4 / OX40L Antibody (clone ANC10G1, Biotin) LS-C134809

LS-C134809 is a Biotin mouse anti-TNFSF4 / OX40L monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Flow Cytometry and Functional Assay.

About TNFSF4 / OX40L: TNFSF4 / OX40L is a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. (more)

Flow Cytometry Image
Anti-DLX2 Antibody (clone 4B9) IHC-plus™ LS-B5395

LS-B5395 is a mouse anti-DLX2 monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About DLX2: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. (more)

Immunohistochemistry Image
Anti-IL1RN Antibody (clone 1H5) LS-C139122

LS-C139122 is a mouse anti-IL1RN monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunoprecipitation and Western blot.

About IL1RN: IL1RN is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. (more)

Western blot Image
Anti-FBN1 / Fibrillin 1 Antibody (clone 3H6) IHC-plus™ LS-B6083

LS-B6083 is a mouse anti-FBN1 / Fibrillin 1 monoclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About FBN1 / Fibrillin 1: Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-1-containing microfibrils provide long-term force bearing structural support. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively. (more)

Immunohistochemistry Image
Anti-IL6R / IL6 Receptor Antibody IHC-plus™ LS-B6362

LS-B6362 is a rabbit anti-IL6R / IL6 Receptor polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About IL6R / IL6 Receptor: IL6R / IL6 Receptor is a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9. (more)

Immunohistochemistry Image
Anti-IL17A Antibody IHC-plus™ LS-B7397

LS-B7397 is a rabbit anti-IL17A polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin, Neutralization and Western blot.

About IL17A: IL17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. (more)

Immunohistochemistry Image
Anti-PTP1B Antibody (aa16-65) IHC-plus™ LS-B7639

LS-B7639 is a rabbit anti-PTP1B polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay, Immunohistochemistry - Paraffin and Western blot.

About PTP1B: PTP1B is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. (more)

Immunohistochemistry Image
Anti-CD300A Antibody (clone P192, FITC) LS-C187547

LS-C187547 is a Fluorescein mouse anti-CD300A monoclonal antibody approved for use in Flow Cytometry.

About CD300A: Inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation. (more)

Flow Cytometry Image
Anti-ZFP91 Antibody (aa216-245) IHC-plus™ LS-B10151

LS-B10151 is a rabbit anti-ZFP91 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About ZFP91: ZFP91 is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. (more)

Immunohistochemistry Image
Anti-TIGIT Antibody (aa21-234) LS-C296579

LS-C296579 is a rabbit anti-TIGIT polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About TIGIT: Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells. (more)

Western blot Image
Anti-Lymphotoxin-Beta / LTB Antibody (aa58-304, FITC) LS-C301349

LS-C301349 is a Fluorescein rabbit anti-Lymphotoxin-Beta / LTB polyclonal antibody approved for use in Enzyme-Linked Immunosorbent Assay and Western blot.

About Lymphotoxin-Beta / LTB: Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2/beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms. (more)

Western blot Image
Anti-CD207 / Langerin Antibody (clone 12D6) LS-C312086

LS-C312086 is a mouse anti-CD207 / Langerin monoclonal antibody approved for use in Immunohistochemistry - Frozen and Immunohistochemistry - Paraffin.

About CD207 / Langerin: Calcium-dependent lectin displaying mannose-binding specificity. Induces the formation of Birbeck granules (BGs); is a potent regulator of membrane superimposition and zippering. Binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. Facilitates uptake of antigens and is involved in the routing and/or processing of antigen for presentation to T cells. Major receptor on primary Langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. Protects against human immunodeficiency virus-1 (HIV-1) infection. Binds to high-mannose structures present on the envelope glycoprotein which is followed by subsequent targeting of the virus to the Birbeck granules leading to its rapid degradation. (more)

Immunohistochemistry Image
Anti-NCR1 / NKP46 Antibody (aa55-104) IHC-plus™ LS-B12032

LS-B12032 is a rabbit anti-NCR1 / NKP46 polyclonal antibody approved for use in Immunohistochemistry - Paraffin and Western blot.

About NCR1 / NKP46: NKp46/CD335 is expressed on activated and resting NK cells but not on T or B cells and belongs to a family of receptors termed natural cytotoxicity receptors (NCR). Their engagement induces a strong activation of NK-mediated cytolysis and direct correlation exists between the surface density of NCR and the ability of NK cells to kill various target cells. (more)

Immunohistochemistry Image
Most Popular ELISA Kits
Rat TIMP2 ELISA Kit (Sandwich ELISA) - LS-F2962

LS-F2962 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat TIMP2 in samples of Cell Culture Supernatants, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of TIMP2 as low as 156 picograms per milliliter.

About TIMP2: TIMP2 is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. (more)

 Image
Human FGF5 ELISA Kit (Sandwich ELISA) - LS-F3590

LS-F3590 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human FGF5 in samples of Cell Culture Supernatants, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of FGF5 as low as 24.58 picograms per milliliter.

About FGF5: FGF5 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. (more)

 Image
Human HMG1 / HMGB1 ELISA Kit (Sandwich ELISA) - LS-F4038

LS-F4038 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human HMG1 / HMGB1 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of HMG1 / HMGB1 as low as 62.5 picograms per milliliter.

About HMG1 / HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. (more)

 Image
Rat APOA1 / Apolipoprotein A 1 ELISA Kit (Sandwich ELISA) - LS-F4180

LS-F4180 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat APOA1 / Apolipoprotein A 1 in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of APOA1 / Apolipoprotein A 1 as low as 0.08 nanograms per millilter.

About APOA1 / Apolipoprotein A 1: APOA1 promotes cholesterol efflux from tissues to the liver for excretion. Apolipoprotein A-I is the major protein component of high density lipoprotein (HDL) in the plasma. Synthesized in the liver and small intestine, it consists of two identical chains of 77 amino acids; an 18-amino acid signal peptide is removed co-translationally and a 6-amino acid propeptide is cleaved post-translationally. Variation in the latter step, in addition to modifications leading to so-called isoforms, is responsible for some of the polymorphism observed. APOA1 is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. (more)

 Image
Rat Complement C3a ELISA Kit (Sandwich ELISA) - LS-F4209

LS-F4209 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat Complement C3a in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C3a as low as 6.25 picograms per milliliter.

About Complement C3a: C3a is one of the proteins formed by the cleavage of complement component 3; the other is C3b. C3a is a 77 residue peptide that binds to the C3a receptor (C3aR) a class A G protein-coupled receptor. It stimulates mast cell degranulation, thus triggering an immune response. C3a plays an important role in chemotaxis, though not as important a role as C5a. It is also an anaphylatoxin and the precursor of the important cytokine (adipokine) ASP through its interaction with carboxypeptidase B. Because C3a is rapidly degraded in serum, stable small molecule agonists and antagonists may be used as tools to probe the physiological effects of C3a in vivo. (more)

 Image
Rat MPO / Myeloperoxidase ELISA Kit (Sandwich ELISA) - LS-F4305

LS-F4305 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat MPO / Myeloperoxidase in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of MPO / Myeloperoxidase as low as 0.313 nanograms per millilter.

About MPO / Myeloperoxidase: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains (12 kD) and 2 heavy chains (60 kD). This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils. It is released in a degranulation process in response to bursts of oxygen consumption, which also forms H2O2. MPO and H2O2 form a complex that oxidases a large variety of substances some of which have microbicidal effects. (more)

 Image
Human TTR / Transthyretin ELISA Kit (Sandwich ELISA) - LS-F4655

LS-F4655 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TTR / Transthyretin in samples of Cell Culture Supernatants, Cell Lysates, Cerebrospinal Fluid, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TTR / Transthyretin as low as 0.313 nanograms per millilter.

About TTR / Transthyretin: TTR / Transthyretin is transthyretin, one of the three prealbumins including alpha-1-antitrypsin, transthyretin and orosomucoid. Transthyretin is a carrier protein; it transports thyroid hormones in the plasma and cerebrospinal fluid, and also transports retinol (vitamin A) in the plasma. The protein consists of a tetramer of identical subunits. More than 80 different mutations in this gene have been reported; most mutations are related to amyloid deposition, affecting predominantly peripheral nerve and/or the heart, and a small portion of the gene mutations is non-amyloidogenic. (more)

 Image
Human SORD / Sorbitol Dehydrogenase ELISA Kit (Sandwich ELISA) - LS-F4731

LS-F4731 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human SORD / Sorbitol Dehydrogenase in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SORD / Sorbitol Dehydrogenase as low as 0.313 nanograms per millilter.

About SORD / Sorbitol Dehydrogenase: Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor. (more)

 Image
Human FCGR1A / CD64 ELISA Kit (Sandwich ELISA) - LS-F4795

LS-F4795 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human FCGR1A / CD64 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of FCGR1A / CD64 as low as 78.13 picograms per milliliter.

About FCGR1A / CD64: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. (more)

 Image
Human CD32A ELISA Kit (Sandwich ELISA) - LS-F4796

LS-F4796 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human CD32A in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of CD32A as low as 46.88 picograms per milliliter.

About CD32A: This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. (more)

 Image
Rat APOB / Apolipoprotein B ELISA Kit (Sandwich ELISA) - LS-F4843

LS-F4843 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat APOB / Apolipoprotein B in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of APOB / Apolipoprotein B as low as 6.25 nanograms per millilter.

About APOB / Apolipoprotein B: Apolipoprotein B (ApoB) is the main apolipoprotein of chylomicrons and low density lipoproteins (LDL). The protein occurs in the plasma in 2 main isoforms, apoB-48 and apoB-100. The first is synthesized exclusively by the gut, the second by the liver. The intestinal (B-48) and hepatic (B-100) forms of apoB are coded by a single gene and by a single mRNA transcript larger than 16 kb. The 2 proteins share a common amino terminal sequence. In the ApoB-100 isoform the precursor has 4563 amino acids, and the mature apoB-100 has 4536 amino acid residues. Mature, circulating B-48 is homologous over its entire length (estimated to be between 2130 and 2144 amino acid residues) with the amino-terminal portion of B-100 and contains no sequence from the carboxyl end of B-100. (more)

 Image
Human Complement C2 ELISA Kit (Sandwich ELISA) - LS-F5291

LS-F5291 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human Complement C2 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C2 as low as 0.625 nanograms per millilter.

About Complement C2: Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined. (more)

 Image
Human SOD1 / Cu-Zn SOD ELISA Kit (Sandwich ELISA) - LS-F5770

LS-F5770 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human SOD1 / Cu-Zn SOD in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SOD1 / Cu-Zn SOD as low as 62.5 picograms per milliliter.

About SOD1 / Cu-Zn SOD: SOD1 / Cu-Zn SOD binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. (more)

 Image
Human SLC2A4 / GLUT-4 ELISA Kit (Sandwich ELISA) - LS-F5832

LS-F5832 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human SLC2A4 / GLUT-4 in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SLC2A4 / GLUT-4 as low as 0.625 nanograms per millilter.

About SLC2A4 / GLUT-4: SLC2A4 / GLUT-4 is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). (more)

 Image
Mouse CFB / Complement Factor B ELISA Kit (Sandwich ELISA) - LS-F5963

LS-F5963 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse CFB / Complement Factor B in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of CFB / Complement Factor B as low as 0.781 nanograms per millilter.

About CFB / Complement Factor B: CFB / Complement Factor B is complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. (more)

 Image
Human SOD3 ELISA Kit (Sandwich ELISA) - LS-F5969

LS-F5969 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human SOD3 in samples of Cell Lysates, Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of SOD3 as low as 57 picograms per milliliter.

About SOD3: This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM. (more)

 Image
Human DCD / Dermcidin ELISA Kit (Sandwich ELISA) - LS-F6212

LS-F6212 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human DCD / Dermcidin in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of DCD / Dermcidin as low as 0.781 nanograms per millilter.

About DCD / Dermcidin: DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity.Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG. (more)

 Image
Mouse Proenkephalin / PENK ELISA Kit (Sandwich ELISA) - LS-F6615

LS-F6615 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse Proenkephalin / PENK in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Proenkephalin / PENK as low as 78.13 picograms per milliliter.

About Proenkephalin / PENK: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum. (more)

 Image
Human Eosinophil Peroxidase / EPX ELISA Kit (Sandwich ELISA) - LS-F7094

LS-F7094 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human Eosinophil Peroxidase / EPX in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Eosinophil Peroxidase / EPX as low as 1.25 nanograms per millilter.

About Eosinophil Peroxidase / EPX: Eosinophil Peroxidase / EPX is a member of the peroxidase gene family and is expressed in eosinophils. The encoded precursor protein is processed into covalently attached heavy and light chains to form the mature enzyme, which functions as an oxidant. The enzyme is released at sites of parasitic infection or allergen stimulation to mediate lysis of protozoa or parasitic worms. The gene is found in a cluster of three peroxidase genes at chromosome 17q23. Mutations in this gene result in eosinophil peroxidase deficiency. (more)

 Image
Human CLDN3 / Claudin 3 ELISA Kit (Sandwich ELISA) - LS-F7157

LS-F7157 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human CLDN3 / Claudin 3 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CLDN3 / Claudin 3 as low as 0.313 nanograms per millilter.

About CLDN3 / Claudin 3: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. (more)

 Image
Human AIMP1 / EMAP II ELISA Kit (Sandwich ELISA) - LS-F7291

LS-F7291 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human AIMP1 / EMAP II in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of AIMP1 / EMAP II as low as 125 picograms per milliliter.

About AIMP1 / EMAP II: Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. (more)

 Image
Mouse IL1F9 ELISA Kit (Sandwich ELISA) - LS-F7319

LS-F7319 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse IL1F9 in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of IL1F9 as low as 7.81 picograms per milliliter.

About IL1F9: Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. (more)

 Image
Mouse GCLC ELISA Kit (Sandwich ELISA) - LS-F7417

LS-F7417 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse GCLC in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of GCLC as low as 0.313 nanograms per millilter.

About GCLC: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction. (more)

 Image
Human GLO1 / Glyoxalase I ELISA Kit (Sandwich ELISA) - LS-F7522

LS-F7522 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human GLO1 / Glyoxalase I in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of GLO1 / Glyoxalase I as low as 1.56 nanograms per millilter.

About GLO1 / Glyoxalase I: Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis. (more)

 Image
Rat APOC3 / Apolipoprotein C III ELISA Kit (Sandwich ELISA) - LS-F7840

LS-F7840 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat APOC3 / Apolipoprotein C III in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of APOC3 / Apolipoprotein C III as low as 0.71 nanograms per millilter.

About APOC3 / Apolipoprotein C III: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. (more)

 Image
Mouse CYP2E1 ELISA Kit (Sandwich ELISA) - LS-F7860

LS-F7860 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse CYP2E1 in samples of Cell Culture Supernatants, Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CYP2E1 as low as 3.13 nanograms per millilter.

About CYP2E1: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. (more)

 Image
Human TNNT2 / CTNT ELISA Kit (Sandwich ELISA) - LS-F8077

LS-F8077 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TNNT2 / CTNT in samples of Cell Culture Supernatants, Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TNNT2 / CTNT as low as 6.1 picograms per milliliter.

About TNNT2 / CTNT: TNNT2 / CTNT is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. (more)

 Image
Human CLDN5 / Claudin 5 ELISA Kit (Sandwich ELISA) - LS-F8302

LS-F8302 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human CLDN5 / Claudin 5 in samples of Cell Lysates, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CLDN5 / Claudin 5 as low as 31.25 picograms per milliliter.

About CLDN5 / Claudin 5: CLDN5 / Claudin 5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. (more)

 Image
Mouse/Human/Rat WNT3A ELISA Kit (Sandwich ELISA) - LS-F8574

LS-F8574 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse WNT3A in samples of Cell Culture Supernatants, Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of WNT3A as low as 0.156 nanograms per millilter.

About WNT3A: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. (more)

 Image
Human TSG101 ELISA Kit (Sandwich ELISA) - LS-F8581

LS-F8581 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TSG101 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TSG101 as low as 0.313 nanograms per millilter.

About TSG101: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. (more)

 Image
Rat SCD1 / SCD ELISA Kit (Sandwich ELISA) - LS-F8950

LS-F8950 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat SCD1 / SCD in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of SCD1 / SCD as low as 1.56 nanograms per millilter.

About SCD1 / SCD: Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O2 and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. (more)

 Image
Rat ADAMTS4 ELISA Kit (Sandwich ELISA) - LS-F9386

LS-F9386 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat ADAMTS4 in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ADAMTS4 as low as 0.156 nanograms per millilter.

About ADAMTS4: ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. (more)

 Image
Human CSH1 / Placental Lactogen ELISA Kit (Sandwich ELISA) - LS-F9677

LS-F9677 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human CSH1 / Placental Lactogen in samples of Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CSH1 / Placental Lactogen as low as 2.5 nanograms per millilter.

About CSH1 / Placental Lactogen: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. (more)

 Image
Human CP / Ceruloplasmin ELISA Kit (Sandwich ELISA) - LS-F10412

LS-F10412 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human CP / Ceruloplasmin in samples of Cell Culture, Milk, Plasma, Saliva, Serum and Urine. It is based upon a Sandwich assay principle and can be used to detect levels of CP / Ceruloplasmin as low as 0.333 nanograms per millilter.

About CP / Ceruloplasmin: Ceruloplasmin is a blue, copper-binding (6-7 atoms per molecule) glycoprotein. It has ferroxidase activity oxidizing Fe2+ to Fe3+ without releasing radical oxygen species. It is involved in iron transport across the cell membrane. Provides Cu2+ ions for the ascorbate-mediated deaminase degradation of the heparan sulfate chains of GPC1. May also play a role in fetal lung development or pulmonary antioxidant defense. (more)

 Image
Human Alpha MSH ELISA Kit (Competitive EIA) - LS-F10568

LS-F10568 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human Alpha MSH in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of Alpha MSH as low as 1.56 nanograms per millilter. (more)

 Image
IP3 / Inositol Trisphosphate ELISA Kit (Competitive EIA) - LS-F10644

LS-F10644 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of IP3 / Inositol Trisphosphate in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Competitive EIA assay principle and can be used to detect levels of IP3 / Inositol Trisphosphate as low as 0.625 nanograms per millilter. (more)

 Image
Human ADM / Adrenomedullin ELISA Kit (Sandwich ELISA) - LS-F10754

LS-F10754 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human ADM / Adrenomedullin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ADM / Adrenomedullin as low as 15.6 picograms per milliliter.

About ADM / Adrenomedullin: Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. (more)

 Image
Human DAB2 ELISA Kit (Sandwich ELISA) - LS-F11276

LS-F11276 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human DAB2 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of DAB2 as low as 0.156 nanograms per millilter.

About DAB2: Adapter protein that functions as clathrin-associated sorting protein (CLASP) required for clathrin-mediated endocytosis of selected cargo proteins. Can bind and assemble clathrin, and binds simultaneously to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) and cargos containg non-phosphorylated NPXY internalization motifs, such as the LDL receptor, to recruit them to clathrin-coated pits. Can function in clathrin-mediated endocytosis independently of the AP-2 complex. Involved in endocytosis of integrin beta-1; this function seems to redundant with the AP-2 complex and seems to require DAB2 binding to endocytosis accessory EH domain-containing proteins such as EPS15, EPS15L1 and ITSN1. Involved in endocytosis of cystic fibrosis transmembrane conductance regulator/CFTR. (more)

 Image
Human ELN / Elastin ELISA Kit (Sandwich ELISA) - LS-F11366

LS-F11366 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human ELN / Elastin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of ELN / Elastin as low as 0.625 nanograms per millilter.

About ELN / Elastin: Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle. (more)

 Image
Mouse HAMP / Hepcidin ELISA Kit (Sandwich ELISA) - LS-F11620

LS-F11620 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse HAMP / Hepcidin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HAMP / Hepcidin as low as 6.25 picograms per milliliter.

About HAMP / Hepcidin: Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma. Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed:22306005). (more)

 Image
Rat HIF1A / HIF1 Alpha ELISA Kit (Sandwich ELISA) - LS-F11633

LS-F11633 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat HIF1A / HIF1 Alpha in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HIF1A / HIF1 Alpha as low as 7.8 picograms per milliliter.

About HIF1A / HIF1 Alpha: Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. (more)

 Image
Rat HMOX1 / HO-1 ELISA Kit (Sandwich ELISA) - LS-F11649

LS-F11649 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat HMOX1 / HO-1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HMOX1 / HO-1 as low as 0.625 nanograms per millilter.

About HMOX1 / HO-1: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. (more)

 Image
Rat IGFBP3 ELISA Kit (Sandwich ELISA) - LS-F11693

LS-F11693 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat IGFBP3 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of IGFBP3 as low as 0.156 nanograms per millilter.

About IGFBP3: IGFBP3 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (more)

 Image
Human MT2A / Metallothionein 2A ELISA Kit (Sandwich ELISA) - LS-F12092

LS-F12092 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human MT2A / Metallothionein 2A in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of MT2A / Metallothionein 2A as low as 0.312 nanograms per millilter.

About MT2A / Metallothionein 2A: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. (more)

 Image
Human NOS2 / iNOS ELISA Kit (Sandwich ELISA) - LS-F12167

LS-F12167 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human NOS2 / iNOS in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of NOS2 / iNOS as low as 15.6 picograms per milliliter.

About NOS2 / iNOS: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such COX2. (more)

 Image
Human OCLN / Occludin ELISA Kit (Sandwich ELISA) - LS-F12208

LS-F12208 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human OCLN / Occludin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of OCLN / Occludin as low as 0.156 nanograms per millilter.

About OCLN / Occludin: OCLN / Occludin is an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. (more)

 Image
Mouse Osteocalcin ELISA Kit (Sandwich ELISA) - LS-F12227

LS-F12227 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse Osteocalcin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Osteocalcin as low as 15.6 picograms per milliliter.

About Osteocalcin: Osteocalcin (BGLAP) is secreted by osteoblasts and plays a role in metabolic regulation. It is pro-osteoblastic (bone-building). It is also implicated in bone mineralization and calcium ion homeostasis. Osteocalcin acts as a hormone in the body, causing beta cells in the pancreas to release more insulin, and at the same time directing fat cells to release the hormone adiponectin, which increases sensitivity to insulin. It may play a role in male fertility, enhancing the synthesis of testosterone. (more)

 Image
Human PARP1 ELISA Kit (Sandwich ELISA) - LS-F12266

LS-F12266 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human PARP1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of PARP1 as low as 0.625 nanograms per millilter.

About PARP1: Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP-ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. With EEF1A1 and TXK, forms a complex that acts as a T-helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production. (more)

 Image
Pig TNFRSF1A / TNFR1 ELISA Kit (Sandwich ELISA) - LS-F12819

LS-F12819 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Pig TNFRSF1A / TNFR1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TNFRSF1A / TNFR1 as low as 15.6 picograms per milliliter.

About TNFRSF1A / TNFR1: TNFRSF1A / TNFR1 is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. (more)

 Image
Mouse THBS1 / Thrombospondin-1 ELISA Kit (Sandwich ELISA) - LS-F12876

LS-F12876 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse THBS1 / Thrombospondin-1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of THBS1 / Thrombospondin-1 as low as 1.56 nanograms per millilter.

About THBS1 / Thrombospondin-1: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp (By similarity). Ligand for CD36 mediating antiangiogenic properties. Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors. (more)

 Image
Mouse Complement C1QA ELISA Kit (Sandwich ELISA) - LS-F13098

LS-F13098 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse Complement C1QA in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C1QA as low as 15.6 picograms per milliliter.

About Complement C1QA: Complement C1QA is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q. (more)

 Image
Human HCRT / Orexin ELISA Kit (Sandwich ELISA) - LS-F13364

LS-F13364 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human HCRT / Orexin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of HCRT / Orexin as low as 15.6 picograms per milliliter.

About HCRT / Orexin: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. (more)

 Image
Human PSG3 ELISA Kit (Sandwich ELISA) - LS-F13941

LS-F13941 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human PSG3 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of PSG3 as low as 15.6 picograms per milliliter.

About PSG3: The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. (more)

 Image
Rat REG3G ELISA Kit (Sandwich ELISA) - LS-F14305

LS-F14305 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat REG3G in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of REG3G as low as 0.625 nanograms per millilter.

About REG3G: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury. (more)

 Image
Mouse LF / LTF / Lactoferrin ELISA Kit (Sandwich ELISA) - LS-F15207

LS-F15207 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse LF / LTF / Lactoferrin in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of LF / LTF / Lactoferrin as low as 0.78 nanograms per millilter.

About LF / LTF / Lactoferrin: Transferrins are iron binding transport proteins which can bind two Fe3+ ions in association with the binding of an anion, usually bicarbonate.Lactotransferrin is a major iron-binding and multifunctional protein found in exocrine fluids such as breast milk and mucosal secretions. Has antimicrobial activity, which depends on the extracellular cation concentration. Antimicrobial properties include bacteriostasis, which is related to its ability to sequester free iron and thus inhibit microbial growth, as well as direct bactericidal properties leading to the release of lipopolysaccharides from the bacterial outer membrane. Can also prevent bacterial biofilm development in P.aeruginosa infection. Has weak antifungal activity against C.albicans. (more)

 Image
Mouse VLDLR ELISA Kit (Sandwich ELISA) - LS-F15559

LS-F15559 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse VLDLR in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of VLDLR as low as 0.312 nanograms per millilter.

About VLDLR: The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. This gene encodes a lipoprotein receptor that is a member of the LDLR family and plays important roles in VLDL-triglyceride metabolism and the reelin signaling pathway. Mutations in this gene cause VLDLR-associated cerebellar hypoplasia. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. (more)

 Image
Mouse TPSAB1 / Mast Cell Tryptase ELISA Kit (Sandwich ELISA) - LS-F15881

LS-F15881 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse TPSAB1 / Mast Cell Tryptase in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TPSAB1 / Mast Cell Tryptase as low as 0.156 nanograms per millilter.

About TPSAB1 / Mast Cell Tryptase: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. (more)

 Image
Rat IL1RL1 ELISA Kit (Sandwich ELISA) - LS-F17015

LS-F17015 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat IL1RL1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of IL1RL1 as low as 78 picograms per milliliter.

About IL1RL1: IL1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. (more)

 Image
Rat CD74 / CLIP ELISA Kit (Sandwich ELISA) - LS-F17027

LS-F17027 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Rat CD74 / CLIP in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of CD74 / CLIP as low as 0.312 nanograms per millilter.

About CD74 / CLIP: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. (more)

 Image
Rat TSPO / PBR ELISA Kit (Sandwich ELISA) - LS-F17174

LS-F17174 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat TSPO / PBR in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TSPO / PBR as low as 0.312 nanograms per millilter.

About TSPO / PBR: Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. (more)

 Image
Human NALP3 / NLRP3 ELISA Kit (Sandwich ELISA) - LS-F17337

LS-F17337 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human NALP3 / NLRP3 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of NALP3 / NLRP3 as low as 0.156 nanograms per millilter.

About NALP3 / NLRP3: NALP3 / NLRP3 is a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NALP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, and neonatal-onset multisystem inflammatory disease (NOMID). (more)

 Image
Lipopolysaccharide / LPS ELISA Kit (Sandwich ELISA) - LS-F17912

LS-F17912 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Lipopolysaccharide / LPS in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Lipopolysaccharide / LPS as low as 0.78 nanograms per millilter.

About Lipopolysaccharide / LPS: Lipopolysaccharides (LPS), also known as lipoglycans and endotoxin, are large molecules consisting of a lipid and a polysaccharide composed of O-antigen, outer core and inner core joined by a covalent bond; they are found in the outer membrane of Gram-negative bacteria, and elicit strong immune responses in animals. (more)

 Image
Human PYCARD / ASC / TMS1 ELISA Kit (Sandwich ELISA) - LS-F19843

LS-F19843 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human PYCARD / ASC / TMS1 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of PYCARD / ASC / TMS1 as low as 0.156 nanograms per millilter.

About PYCARD / ASC / TMS1: Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. (more)

 Image
Human TRIM72 / MG53 ELISA Kit (Sandwich ELISA) - LS-F19895

LS-F19895 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human TRIM72 / MG53 in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of TRIM72 / MG53 as low as 0.156 nanograms per millilter.

About TRIM72 / MG53: Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membrane damage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization at the injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to the injury site, leading to membrane patch formation. Probably acts upstream of the Ca2+-dependent membrane resealing process. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membrane budding and exocytosis. (more)

 Image
Human CFTR ELISA Kit (Sandwich ELISA) - LS-F21167

LS-F21167 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human CFTR in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of CFTR as low as 0.16 nanograms per millilter.

About CFTR: CFTR (Cystic Fibrosis Transmembrane Conductance Regulator), sometimes also referred as ABCC7 (ATP-binding cassette, Subfamily C, Member 7), is a member of the ATP binding cassette (ABC) transporter family. CFTR functions as a chloride channel and controls the regulation of other transport pathways. Homozygous mutations in the CFTR gene cause cystic fibrosis (CF), formerly known as mucoviscidosis, a common hereditary disorder characterized by severe abnormalities in respiratory, digestive and other organ systems. Approximately 70% of the mutations in CF patients correspond to a specific deletion of 3 base pairs, which results in the loss of a phenylalanine at position 508. (more)

 Image
Mouse VWF / Von Willebrand Factor ELISA Kit (Sandwich ELISA) - LS-F22891

LS-F22891 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse VWF / Von Willebrand Factor in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of VWF / Von Willebrand Factor as low as 1.25 nanograms per millilter.

About VWF / Von Willebrand Factor: Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma. (more)

 Image
Mouse NT-proBNP ELISA Kit (Sandwich ELISA) - LS-F23107

LS-F23107 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Mouse NT-proBNP in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of NT-proBNP as low as 15.63 picograms per milliliter. (more)

 Image
Rat GUSB / Beta Glucuronidase ELISA Kit (Sandwich ELISA) - LS-F24073

LS-F24073 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat GUSB / Beta Glucuronidase in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of GUSB / Beta Glucuronidase as low as 78.13 picograms per milliliter.

About GUSB / Beta Glucuronidase: GUSB / Beta Glucuronidase is a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4,6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. Alternative splicing results in multiple transcript variants. There are many pseudogenes of this locus in the human genome. (more)

 Image
Mouse GLP2 ELISA Kit (Sandwich ELISA) (Custom) - LS-F25094

LS-F25094 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Mouse GLP2 in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of GLP2 as low as 9.22 picograms per milliliter.

About GLP2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. (more)

 Image
Mouse/Human/Rat Histone H3 ELISA Kit (Sandwich ELISA) - LS-F25165

LS-F25165 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the detection of Human Histone H3 in samples of Cell Lysates and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Histone H3 as low as 0.312 nanograms per millilter.

About Histone H3: Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the 'beads on a string' structure. Histone proteins are highly post-translationally modified however Histone H3 is the most extensively modified of the five histones. The term "Histone H3" alone is purposely ambiguous in that it does not distinguish between sequence variants or modification state. Histone H3 is an important protein in the emerging field of epigenetics, where its sequence variants and variable modification states are thought to play a role in the dynamic and long term regulation of genes. (more)

 Image
Rat Complement C1q ELISA Kit (Sandwich ELISA) - LS-F25231

LS-F25231 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Rat Complement C1q in samples of Plasma and Serum. It is based upon a Sandwich assay principle and can be used to detect levels of Complement C1q as low as 0.781 nanograms per millilter.

About Complement C1q: C1q is a 400kDa protein formed from 18 peptide chains in 3 subunits (C1QA, C1QB, and C1QC). Each 6 peptide subunit consists of a Y-shaped pair of triple peptide helices joined at the stem and ending in a globular non-helical head. (more)

 Image
Human Collagen I ELISA Kit (Sandwich ELISA) - LS-F26726

LS-F26726 is a 96-well enzyme-linked immunosorbent assay (ELISA) for the Quantitative detection of Human Collagen I in samples of Cell Culture Supernatants, Plasma, Serum and Tissue Homogenates. It is based upon a Sandwich assay principle and can be used to detect levels of Collagen I as low as 1 nanograms per millilter.

About Collagen I: Type I collagen is the most abundant collagen of the human body which forms large, eosinophilic fibers known as collagen fibers. It is present in scar tissue, the end product when tissue heals by repair, as well as tendons, ligaments, the endomysium of myofibrils, the organic part of bone, the dermis, the dentin and organ capsules. Collagen, type I, alpha 1, also known as alpha-1 type I collagen, is encoded by the COL1A1 gene. Collagen alpha-2(I) chain is encoded by the COL1A2 gene. Mutations in this gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. (more)

 Image
Most Popular Proteins
Human ARC / Arg3.1 Recombinant (His) Protein - LS-G2230

LS-G2230 is a Human ARC / Arg3.1 recombinant protein generated in E. coli. This protein has been engineered to contain a His tag.

About ARC / Arg3.1: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors By similarity. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. (more)

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human ITGB1 / Integrin Beta 1 / CD29 Recombinant (His) Protein - LS-G2709

LS-G2709 is a Human ITGB1 / Integrin Beta 1 / CD29 recombinant protein generated in E. coli. This protein has been engineered to contain a His tag.

About ITGB1 / Integrin Beta 1 / CD29: Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha-4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha-11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha-4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, alpha-2/beta-1, alpha-6/beta-1 and alpha-7/beta-1 are receptors for lamimin. Integrin alpha-4/beta-1 is a receptor for VCAM1. It recognizes the sequence Q-I-D-S in VCAM1. (more)

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Staphylococcus aureus entB / Enterotoxin Type B Recombinant (His) Protein - LS-G23200

LS-G23200 is a Staphylococcus aureus entB / Enterotoxin Type B recombinant protein generated in Yeast. This protein has been engineered to contain a His tag.

About entB / Enterotoxin Type B: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. (more)


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number