LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-CCL4 / MIP-1 Beta Antibody (aa27-92) LS-C71941


Wt. Vol. Conc. Price
50 µg - 1 mg/ml $650
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular CCL4 / MIP-1 Beta Antibodies

Anti-CCL4 / MIP-1 Beta Antibody LS-C104570
Rabbit Polyclonal to Mouse CCL4 / MIP-1 Beta
Western blot, ELISA, Neutralization
Western blot Image
Anti-CCL4 / MIP-1 Beta Antibody (Internal) IHC-plus™ LS-B10079
Rabbit Polyclonal (IgG) to Human CCL4 / MIP-1 Beta
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry Image
Anti-CCL4 / MIP-1 Beta Antibody (aa19-92) IHC-plus™ LS-B11693
Rabbit Polyclonal (IgG) to Human CCL4 / MIP-1 Beta
IHC - Paraffin, ELISA
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Chicken Polyclonal (IgY) to Human CCL4 / MIP-1 Beta
Western blot, ELISA


Human CCL4 / MIP-1 Beta
Human (tested or 100% immunogen sequence identity)
Monkey, Horse (at least 90% immunogen sequence identity)
IgY Polyclonal
Immunoaffinity purified


  • Western blot
  • ELISA (0.1 - 0.5 µg/ml)

Specificity and Use

CCL4 / MIP-1 Beta antibody was raised against synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. Percent identity by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Horse (97%); Panda (90%); Bovine, Dog, Pig (87%); Rat, Hamster, Rabbit (84%); Mouse (81%).
Species cross-reactivity: Cross-reacts with Human. Not yet tested in other species.
Suitable for use in ELISA and Western Blot. ELISA: 0.1-0.5 ug/ml.


PBS, pH 7.2. No preservative added.
+4°C or -20°C, Avoid repeated freezing and thawing.
For research use only.

About CCL4 / MIP-1 Beta

P13236 NM_002984 NP_002975.1

CCL4 Antibody, ACT2 Antibody, Act-2 Antibody, AT744.1 Antibody, C-C motif chemokine 4 Antibody, Chemokine (C-C motif) ligand 4 Antibody, CC chemokine ligand 4 Antibody, HC21 Antibody, LAG1 Antibody, MIP1B Antibody, MIP1B1 Antibody, LAG-1 Antibody, SCYA2 Antibody, Secreted protein G-26 Antibody, SIS-gamma Antibody, MIP-1-beta Antibody, MIP-1-beta(1-69) Antibody, Small-inducible cytokine A4 Antibody, T-cell activation protein 2 Antibody, G-26 Antibody, Lymphocyte-activation gene 1 Antibody, PAT 744 Antibody, Protein H400 Antibody, SCYA4 Antibody

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells.

Requested From: United States
Date Requested: 1/18/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number