Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15645-50 50 µl (2.08 mg/ml) $460 
Proenkephalin / PENK Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Proenkephalin / PENK Antibody - Western blot analysis of extracts of various cell lines.
Proenkephalin / PENK Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Proenkephalin / PENK Antibody - Western blot analysis of extracts of various cell lines.
1 of 2
2 of 2

PathPlus™ Polyclonal Rabbit anti‑Human Proenkephalin / PENK Antibody (aa 25‑267, IHC, WB) LS‑B15645

PathPlus™ Polyclonal Rabbit anti‑Human Proenkephalin / PENK Antibody (aa 25‑267, IHC, WB) LS‑B15645

Note: This antibody replaces LS-C334627
Antibody:
Proenkephalin / PENK Rabbit anti-Human Polyclonal (aa 25-267) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15645-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
Proenkephalin / PENK Rabbit anti-Human Polyclonal (aa 25-267) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PENK (proenkephalin) is an endogenous opioid polypeptide hormone that produces multiple enkephalin peptides. Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum. References: The UniProt Consortium. Nucleic Acids Res. 47: D506-515 (2019); Nucleic Acids Res. 2016 Jan 4;44(D1):D733-45, PMID:26553804
Target
Human Proenkephalin / PENK
Synonyms
PENK | Enkephalin A | Met enkephalin | Preproenkephalin | Proenkephalin | Proenkephalin-A
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1). ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF
Epitope
aa 25-267
Specificity
Human Proenkephalin / PENK
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 30kDa, while the observed MW by Western blot was 31kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Proenkephalin / PENK
P01210 NM_006211 NP_006202.1

Validation

Proenkephalin / PENK Antibody - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

LSBio Ratings

PathPlus™ Proenkephalin / PENK Antibody (aa 25-267) for IHC, WB/Western LS-B15645 has an LSBio Rating of
Publications (4)
Laboratory Validation Score (5)

Publications (1)

Novel bifunctional hybrid compounds designed to enhance the effects of opioids and antagonize the pronociceptive effects of nonopioid peptides as potent analgesics in a rat model of neuropathic pain. Anna Piotrowska, Joanna Starnowska-Sokól, Wioletta Makuch, Joanna Mika, Ewa Witkowska, Dagmara Tymecka, Angelika Ignaczak, Beata Wilenska, Aleksandra Misicka, Barbara Przewlocka. Pain. 2021 February;162:432-445.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/29/2024