Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

SPP1 / Osteopontin Antibody LS-C749076

Western blot analysis of extracts of various cell lines, using SPP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

SPP1 / Osteopontin Antibody LS-C749076

Rabbit Polyclonal to Human SPP1 / Osteopontin
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human SPP1 / Osteopontin
Human, Mouse, Rat
Unconjugated, Unmodified


Osteopontin antibody LS-C749076 is an unconjugated rabbit polyclonal antibody to Osteopontin (SPP1) from human, mouse and rat. Validated for WB.

Human SPP1 / Osteopontin
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human SPP1 (NP_001035147.1). NDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI
The predicted MW is 32kDa/33kDa/35kDa, while the observed MW by Western blot was 45, 47kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SPP1 / Osteopontin
P10451 NM_000582 NP_000573.1

Publications (0)

Reviews (0)

Featured Products

Requested From: United States
Date Requested: 6/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy