Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > PPP1R12A / MYPT1 > LS-C407949
 
Print Page  
Catalog Number Size Price
LS-C407949-10 10 µg $318 
LS-C407949-100 100 µg $470 
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromoge
PPP1R12A / MYPT1 Antibody - PPP1R12A antibody IHC-paraffin. IHC(P): Human Glioma Tissue.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of SiHa cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - PPP1R12A antibody Western blot. All lanes: Anti PPP1R12A at 0.5 ug/ml. Lane 1: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 150 kD. Observed band size: 150 kD.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of U251 cells using anti-PPP1R12A antibody. Overlay histogram showing U251 cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of SiHa cells using anti-PPP1R12A antibody. Overlay histogram showing SiHa cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of Hela cells using anti-PPP1R12A antibody. Overlay histogram showing Hela cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromoge
PPP1R12A / MYPT1 Antibody - PPP1R12A antibody IHC-paraffin. IHC(P): Human Glioma Tissue.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of U251 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in immunocytochemical section of SiHa cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-PPP1R12A Antibody overnight at 4°C. DyLight®488 Conjugated Avidin was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1094) with DAB as the chromogen.
PPP1R12A / MYPT1 Antibody - PPP1R12A antibody Western blot. All lanes: Anti PPP1R12A at 0.5 ug/ml. Lane 1: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 150 kD. Observed band size: 150 kD.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of U251 cells using anti-PPP1R12A antibody. Overlay histogram showing U251 cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of SiHa cells using anti-PPP1R12A antibody. Overlay histogram showing SiHa cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R12A / MYPT1 Antibody - Flow Cytometry analysis of Hela cells using anti-PPP1R12A antibody. Overlay histogram showing Hela cells stained with anti-PPP1R12A antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPP1R12A Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Human PPP1R12A / MYPT1 Antibody (aa1‑40, IHC, WB) LS‑C407949

Polyclonal Rabbit anti‑Human PPP1R12A / MYPT1 Antibody (aa1‑40, IHC, WB) LS‑C407949

Submit Review LSBio Guarantee
Antibody:
PPP1R12A / MYPT1 Rabbit anti-Human Polyclonal (aa1-40) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407949-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
PPP1R12A / MYPT1 Rabbit anti-Human Polyclonal (aa1-40) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep
Format:
Unconjugated, Unmodified

Specifications

Description
MYPT1 antibody LS-C407949 is an unconjugated rabbit polyclonal antibody to MYPT1 (PPP1R12A) (aa1-40) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human PPP1R12A / MYPT1
Synonyms
PPP1R12A | M130 | MYPT1 | MBS | Myosin binding subunit
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Sheep (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human PPP1R12A (1-40 aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.
Epitope
aa1-40
Specificity
Expressed in striated muscles, specifically in type 2a fibers (at protein level). .
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PPP1R12A / MYPT1
O14974 NM_002480 NP_002471.1

Publications (0)

Submit a Publication for LS-C407949

Customer Reviews (0)

Submit a review for LS-C407949

Featured Products

Product
PPP1R12A / MYPT1 Antibody (aa800‑850) LS‑C287730
Species: Human
Applications: Western blot, Immunoprecipitation
Product
PPP1R12A / MYPT1 Antibody (phospho‑Thr850) LS‑C91059
Species: Human, Monkey, Mouse, Rat, Dog, Horse, Rabbit, Chicken, Zebrafish
Applications: Western blot
PPP1R12A / MYPT1 Antibody - Anti-PPP1R12A / MYPT1 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
IHC‑plus™ PPP1R12A / MYPT1 Antibody LS‑B3836
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Peptide Enzyme-Linked Immunosorbent Assay
Product
PPP1R12A / MYPT1 Antibody (phospho‑Thr850) LS‑C130965
Species: Human, Chicken
Applications: Western blot
PPP1R12A / MYPT1 Antibody - Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using MYPT1 (Phospho-Thr696) Antibody. The picture on the right is blocked with the phospho peptide.
PPP1R12A / MYPT1 Antibody (phospho‑Thr696) LS‑C199296
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Peptide Enzyme-Linked Immunosorbent Assay
PPP1R12A / MYPT1 Antibody - Immunohistochemistry analysis of paraffin-embedded human breast carcinoma tissue, using MYPT1 Antibody. The picture on the right is blocked with the synthesized peptide.
PPP1R12A / MYPT1 Antibody (aa661‑710) LS‑C117671
Species: Human, Mouse, Rat
Applications: IHC, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
See all PPP1R12A / MYPT1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/26/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com