Rat MAPK3 / ERK1

Rabbit

Rat, Mouse, Hamster, Rabbit (tested or 100% immunogen sequence identity)

IgG Polyclonal

Unconjugated. Also available conjugated with APC, Biotin, FITC, HRP, PE.

Immunoaffinity purified

Unmodified

Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-Terminus 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).

aa372-406

Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35.

• Western blot (0.1 - 2 µg/ml)
• Immunoprecipitation
• Functional Assay

Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.

0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 0.1 mM EDTA.

Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: P27361 NCBI: X60188 CAA42744.1