Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15527-50 50 µl $460 
NR4A1 / NUR77 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
NR4A1 / NUR77 Antibody - Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:200.
NR4A1 / NUR77 Antibody - Western blot analysis of extracts of mouse testis.
NR4A1 / NUR77 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
NR4A1 / NUR77 Antibody - Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:200.
NR4A1 / NUR77 Antibody - Western blot analysis of extracts of mouse testis.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human NR4A1 / NUR77 Antibody (IHC, WB) LS‑B15527

IHC‑plus™ Polyclonal Rabbit anti‑Human NR4A1 / NUR77 Antibody (IHC, WB) LS‑B15527

Note: This antibody replaces LS-C334868
Antibody:
NR4A1 / NUR77 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15527-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NR4A1 / NUR77 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
NUR77 antibody LS-B15527 is an unconjugated rabbit polyclonal antibody to mouse NUR77 (NR4A1). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human NR4A1 / NUR77
Synonyms
NR4A1 | GFRP1 | Early response protein NAK1 | HMR | NGFIB | Orphan nuclear receptor TR3 | Orphan receptor tr3 | Steroid receptor TR3 | TR3 | NAK1 | NGFI-B | NP10 | Receptor NGFIB | Testicular receptor 3 | TR3 orphan receptor | N10 | NAK-1 | NUR77 | Orphan nuclear receptor HMR
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NR4A1 (NP_775180.1). MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGL
Specificity
Human NR4A1 / NUR77
Applications
  • IHC
  • IHC - Paraffin (1:100 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 33kDa/64kDa/65kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NR4A1 / NUR77
P22736 NM_002135 NP_002126.2

Validation

NR4A1 / NUR77 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

LSBio Ratings

IHC-plus™ NR4A1 / NUR77 Antibody for IHC, WB/Western LS-B15527 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024