LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
BMP4 Antibody (aa293‑324) LS‑C407900
BMP4 antibody LS-C407900 is an unconjugated rabbit polyclonal antibody to BMP4 from human and mouse. Validated for ELISA and WB.
Catalog
Size
Price
LS-C407900-100
100 µg
$325
Description
BMP4 antibody LS-C407900 is an unconjugated rabbit polyclonal antibody to BMP4 from human and mouse. Validated for ELISA and WB.
Target
Human BMP4
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Predicted
Bovine (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
Immunogen
BMP4 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
Epitope
aa293-324
Specificity
Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About BMP4
P12644 NM_001202 NP_001193.2

Popular BMP4 Products

Anti-BMP4 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat, Rabbit, Chicken
Applications: IHC, IHC - Paraffin, Western blot
Anti-BMP4 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:100.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Hamster, Horse, Pig, Rabbit, Chicken, Xenopus
Applications: IHC, IHC - Paraffin, Western blot
Anti-BMP4 antibody IHC of human lung, respiratory epithelium. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Mouse, Human, Rat
Applications: ICC, Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA

Publications (0)


Customer Reviews (0)


Images

Western blot

BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.

Western blot

BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.

Western blot

BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.

Western blot

BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
BMP4 antibody Western blot. All lanes: Anti BMP4 at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.

Requested From: United States
Date Requested: 11/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy