LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-MAPK3 / ERK1 Antibody (aa372-406) LS-C16368


Wt. Vol. Conc. Price
100 µg - - $560
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular MAPK3 / ERK1 Antibodies

Anti-MAPK3 / ERK1 Antibody (Internal) IHC-plus™ LS-A2877
Rabbit Polyclonal to Human MAPK3 / ERK1
Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig
IHC - Paraffin
Immunohistochemistry Image
Anti-MAPK3 / ERK1 Antibody (phospho-Thr202/Tyr204) LS-C16352
Rabbit Polyclonal (IgG) to Human MAPK3 / ERK1
Human, Mouse, Rat, Hamster, Chicken
ICC, Immunofluorescence, Western blot, Immunoprecipitation, Flow Cytometry, ELISA
Anti-MAPK3 / ERK1 Antibody (C-Terminus) LS-C209857
Rabbit Polyclonal (IgG) to Zebrafish MAPK3 / ERK1
Western blot, ELISA

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Rat MAPK3 / ERK1
Rat, Mouse, Hamster, Rabbit
Western blot, Immunoprecipitation, Functional Assay


Rat MAPK3 / ERK1
Rat, Mouse, Hamster, Rabbit (tested or 100% immunogen sequence identity)
Human, Monkey, Bat, Bovine, Dog, Horse (at least 90% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified


  • Western blot (0.1 - 2 µg/ml)
  • Immunoprecipitation
  • Functional Assay

Specificity and Use

MAPK3 / ERK1 antibody was raised against synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35.
Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.


0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 0.1 mM EDTA.
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About MAPK3 / ERK1

P27361 X60188 CAA42744.1

MAPK3 Antibody, ERK-1 Antibody, ERT2 Antibody, HUMKER1A Antibody, HS44KDAP Antibody, MAP kinase 1 Antibody, MAP kinase isoform p44 Antibody, MAPK 1 Antibody, MAPK 3 Antibody, p44 Antibody, p44MAPK Antibody, p44-MAPK Antibody, p44ERK1 Antibody, Insulin-stimulated MAP2 kinase Antibody, MAP kinase 3 Antibody, p44-ERK1 Antibody, ERK1 Antibody, PRKM3 Antibody

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF.

Requested From: United States
Date Requested: 12/7/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number