Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23168-20 20 µg $429 
LS-G23168-100 100 µg $679 
LS-G23168-1 1 mg $1,973 
TNF Alpha Protein

Sheep TNF Alpha Protein (Recombinant His) (aa78-234) - LS-G23168

Sheep TNF Alpha Protein (Recombinant His) (aa78-234) - LS-G23168

Description:
TNF Alpha Protein LS-G23168 is a Recombinant Sheep TNF Alpha produced in Yeast aa 78-234 with His tag(s). For Research Use Only
Price
Catalog Number
$429
LS-G23168-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNF Alpha Protein LS-G23168 is a Recombinant Sheep TNF Alpha produced in Yeast aa 78-234 with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TNF Alpha
Synonyms
TNF | APC1 protein | Cachectin | DIF | TNF Alpha | Tumor necrosis factor-alpha | TNF-alpha | TNF-a | TNFA | Tumor necrosis factor | TNF, macrophage-derived | TNF, monocyte-derived | TNFSF2
Species
Sheep
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 78-234
Predicted Molecular Weight
19.2 kD
AA Sequence
LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNF Alpha
P01375 NM_000594 NP_000585.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/19/2024