Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334269-20 20 µl $263 
LS-C334269-50 50 µl $301 
LS-C334269-100 100 µl $359 
LS-C334269-200 200 µl (2.01 mg/ml) $473 
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded mouse spinal cord tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded mouse heart tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human lung cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human liver cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunofluorescence analysis of GFP-RNF168 trangenic U2OS cells.
TP53BP1 / 53BP1 Antibody - Immunofluorescence analysis of U2OS cells.
TP53BP1 / 53BP1 Antibody - Western blot analysis of extracts of A431 cells.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded mouse spinal cord tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded mouse heart tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human lung cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunohistochemistry of paraffin-embedded human liver cancer tissue.
TP53BP1 / 53BP1 Antibody - Immunofluorescence analysis of GFP-RNF168 trangenic U2OS cells.
TP53BP1 / 53BP1 Antibody - Immunofluorescence analysis of U2OS cells.
TP53BP1 / 53BP1 Antibody - Western blot analysis of extracts of A431 cells.
1 of 9
2 of 9
3 of 9
4 of 9
5 of 9
6 of 9
7 of 9
8 of 9
9 of 9

Polyclonal Rabbit anti‑Human TP53BP1 / 53BP1 Antibody (IHC, IF, WB) LS‑C334269

Polyclonal Rabbit anti‑Human TP53BP1 / 53BP1 Antibody (IHC, IF, WB) LS‑C334269

Antibody:
TP53BP1 / 53BP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334269-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
TP53BP1 / 53BP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
53BP1 antibody LS-C334269 is an unconjugated rabbit polyclonal antibody to 53BP1 (TP53BP1) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human TP53BP1 / 53BP1
Synonyms
TP53BP1 | 53BP1 | p202 | p53-binding protein 1 | p53-binding protein 53bp1 | p53BP1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1763-1977 of human TP53BP1 (NP_001135452.1). SSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Specificity
Human TP53BP1 / 53BP1
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 213kDa/214kDa, while the observed MW by Western blot was 255kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TP53BP1 / 53BP1
Q12888 NM_005657 NP_005648.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022