Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C408159-10 10 µg $318 
LS-C408159-100 100 µg $470 
SMAD1 Antibody - SMAD antibody Western blot. All lanes: Anti SMAD at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 4: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Lane 5: 293T Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Lane 7: HELA Whole Cell Lysate at 40 ug. Predicted band size: 52 kD. Observed band size: 52 kD.

Polyclonal Rabbit anti‑Human SMAD1 Antibody (aa240‑270, WB) LS‑C408159

Polyclonal Rabbit anti‑Human SMAD1 Antibody (aa240‑270, WB) LS‑C408159

Antibody:
SMAD1 Rabbit anti-Human Polyclonal (aa240-270) Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C408159-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SMAD1 Rabbit anti-Human Polyclonal (aa240-270) Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
SMAD1 antibody LS-C408159 is an unconjugated rabbit polyclonal antibody to SMAD1 (aa240-270) from human. It is reactive with human, mouse and rat. Validated for WB.
Target
Human SMAD1
Synonyms
SMAD1 | BSP1 | BSP-1 | JV4-1 | MADH1 | Mothers against DPP homolog 1 | JV41 | SMAD family member 1 | TGF-beta signaling protein 1 | MADR1 | HSMAD1 | MAD homolog 1 | Mad-related protein 1 | SMAD 1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270 aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
Epitope
aa240-270
Specificity
Ubiquitous. Highest expression seen in the heart and skeletal muscle.
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SMAD1
Q15797 NM_005900 NP_005891.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2024