Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
RXFP2 / LGR8 Antibody IHC‑plus™ LS‑B13248
Note: This antibody replaces LS-C359192
LGR8 antibody LS-B13248 is an unconjugated rabbit polyclonal antibody to LGR8 (RXFP2) from human, rat, guinea pig and other species. Validated for IHC. Tested on 20 paraffin-embedded human tissues.
50 µg
LGR8 antibody LS-B13248 is an unconjugated rabbit polyclonal antibody to LGR8 (RXFP2) from human, rat, guinea pig and other species. Validated for IHC. Tested on 20 paraffin-embedded human tissues.
Human RXFP2 / LGR8
Human, Rat, Guinea pig, Horse (tested or 100% immunogen sequence identity)
Immunoaffinity purified
  • IHC
  • IHC - Paraffin (10 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
RXFP2 / LGR8 antibody was raised against synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI
Lyophilized from PBS, 0.09% sodium azide, 2% sucrose
Centrifuge the vial prior to opening. Reconstitute with sterile distilled water to a concentration of 1 mg/ml. Vortex and centrifuge again.
Short term 4°C (no longer than 1 week); Long term -20°C; Aliquot to avoid freeze/thaw cycles.
For research use only.
About RXFP2 / LGR8
Q8WXD0 NM_130806 NP_570718.1

Popular RXFP2 / LGR8 Products

Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Horse
Applications: IHC, IHC - Paraffin, Western blot
Anti-RXFP2 / LGR8 antibody IHC of human Brain, Glioblastoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Anti-RXFP2 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Anti-RXFP2 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Western blot of Relaxin Receptor 2 antibody
Species: Human, Mouse, Rat
Applications: Immunofluorescence, Western blot, ELISA

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)

Requested From: United States
Date Requested: 12/15/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy