LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
RXFP2 / LGR8 Antibody LS‑C756591
LGR8 antibody LS-C756591 is an unconjugated rabbit polyclonal antibody to human LGR8 (RXFP2). Validated for Flow, ICC, IHC and WB.
Catalog
Size
Price
LS-C756591-100
100 µg
$355
Description
LGR8 antibody LS-C756591 is an unconjugated rabbit polyclonal antibody to human LGR8 (RXFP2). Validated for Flow, ICC, IHC and WB.
Target
Human RXFP2 / LGR8
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
RXFP2 / LGR8 antibody was raised against a synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
Specificity
No cross reactivity with other proteins.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3
Reconstitution
Add 0.2 ml of distilled water to yield a concentration of 500 µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only.
About RXFP2 / LGR8
Q8WXD0 NM_130806 NP_570718.1

Popular RXFP2 / LGR8 Products

Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Horse
Applications: IHC, IHC - Paraffin, Western blot
Anti-RXFP2 / LGR8 antibody IHC of human Brain, Glioblastoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Anti-RXFP2 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Anti-RXFP2 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin
Western blot of Relaxin Receptor 2 antibody
Species: Human, Mouse, Rat
Applications: Immunofluorescence, Western blot, ELISA

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy