Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

IRF5 Antibody (aa442-472) LS-C407858

IRF5 antibody LS-C407858 is an unconjugated rabbit polyclonal antibody to IRF5 from human, mouse, rat and other species. Validated for IHC and WB.
100 µg
IRF5 antibody LS-C407858 is an unconjugated rabbit polyclonal antibody to IRF5 from human, mouse, rat and other species. Validated for IHC and WB.
Human IRF5
Human, Mouse, Rat, Horse, Rabbit (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
IRF5 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About IRF5
Q13568 NM_002200 NP_116032.1

Popular IRF5 Products

Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.8 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
IRF5 antibody Western blot of SH-SYSY lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit, Zebrafish
Applications: Western blot
Confocal immunofluorescence of IRF5 Antibody with A549 cell followed by Alexa Fluor 489-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclear (blue).
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Species: Mouse, Rat
Applications: Western blot, Immunoprecipitation, ELISA

Publications (0)

Customer Reviews (0)



IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.


IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.


IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.


IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

Requested From: United States
Date Requested: 2/21/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy