LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IRF5 Antibody (aa442‑472) LS‑C407858
IRF5 antibody LS-C407858 is an unconjugated rabbit polyclonal antibody to IRF5 from human, mouse, rat and other species. Validated for IHC and WB.
Catalog
Size
Price
LS-C407858-100
100 µg
Unavailable

Popular IRF5 Products

Antibody
Species: Mouse, Rat
Applications: Western blot, Immunoprecipitation, ELISA
Confocal immunofluorescence of IRF5 Antibody with A549 cell followed by Alexa Fluor 489-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclear (blue).
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
IRF5 antibody LS-C109630 Western blot of SH-SYSY lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit, Zebrafish
Applications: Western blot
Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.8 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Product Description

IRF5 antibody LS-C407858 is an unconjugated rabbit polyclonal antibody to IRF5 from human, mouse, rat and other species. Validated for IHC and WB.
About IRF5
IRF5 is a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Q13568 NM_002200 NP_116032.1

IRF5 Antibody, Interferon regulatory factor 5 Antibody, IRF-5 Antibody, SLEB10 Antibody, IBD14 Antibody


Specifications

Target
Human IRF5
Host
Rabbit
Reactivity
Human, Mouse, Rat, Horse, Rabbit (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
IRF5 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
Epitope
aa442-472
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.

Immunohistochemistry

IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.
IRF5 antibody IHC-paraffin. IHC(P): Mouse Spleen Tissue.

Western blot

IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.
IRF5 antibody Western blot. All lanes: Anti IRF5 at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Lane 5: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

Requested From: 
Date Requested: 7/16/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number