Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13847-50 50 µl $425 
MGMT Antibody - Human Small Intestine, MALT: Formalin-Fixed, Paraffin-Embedded (FFPE)
MGMT Antibody - Immunofluorescence analysis of U2OS cells using MGMT antibody. Blue: DAPI for nuclear staining.
MGMT Antibody - Western blot analysis of HeLa cell lysate using MGMT antibody.
MGMT Antibody - Western blot analysis of extracts of HepG2 cells, using MGMT antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
MGMT Antibody - Human Small Intestine, MALT: Formalin-Fixed, Paraffin-Embedded (FFPE)
MGMT Antibody - Immunofluorescence analysis of U2OS cells using MGMT antibody. Blue: DAPI for nuclear staining.
MGMT Antibody - Western blot analysis of HeLa cell lysate using MGMT antibody.
MGMT Antibody - Western blot analysis of extracts of HepG2 cells, using MGMT antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
1 of 4
2 of 4
3 of 4
4 of 4

IHCPlus™ Polyclonal Rabbit anti‑Human MGMT Antibody (IHC, IF, WB) LS‑B13847

IHCPlus™ Polyclonal Rabbit anti‑Human MGMT Antibody (IHC, IF, WB) LS‑B13847

Note: This antibody replaces LS-C331073
Antibody:
Rabbit Polyclonal to Human MGMT
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B13847-50
50 µl
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
Rabbit Polyclonal to Human MGMT
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
MGMT antibody LS-B13847 is an unconjugated rabbit polyclonal antibody to MGMT from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human MGMT
Synonyms
MGMT
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human MGMT (XP_005252739.1). MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Specificity
Human MGMT
Usage
The predicted MW is 21kDa, while the observed MW by Western blot was 22kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MGMT
P16455 NM_002412 NP_002403.2

Validation

MGMT Antibody - Human Small Intestine, MALT: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Small Intestine, MALT: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Small Intestine, MALT: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ MGMT Antibody for IHC, IF/Immunofluorescence, WB/Western LS-B13847 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 7/11/2020