Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15420-50 50 µl $460 
CD207 / Langerin Antibody - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD207 / Langerin Antibody - Western blot analysis of extracts of various cell lines.
CD207 / Langerin Antibody - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD207 / Langerin Antibody - Western blot analysis of extracts of various cell lines.
1 of 2
2 of 2

IHC‑plus™ Polyclonal Rabbit anti‑Human CD207 / Langerin Antibody (IHC, WB) LS‑B15420

IHC‑plus™ Polyclonal Rabbit anti‑Human CD207 / Langerin Antibody (IHC, WB) LS‑B15420

Note: This antibody replaces LS-C335688
Antibody:
CD207 / Langerin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15420-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CD207 / Langerin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Langerin antibody LS-B15420 is an unconjugated rabbit polyclonal antibody to Langerin (CD207) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human CD207 / Langerin
Synonyms
CD207 | CD207 antigen, langerin | CD207 antigen | CD207 molecule, langerin | CLEC4K | Langerin
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 69-328 of human CD207 (NP_056532.4). GTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Specificity
Human CD207 / LANGERIN.
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 36kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD207 / Langerin
Q9UJ71 NM_015717 NP_056532.4

Validation

CD207 / Langerin Antibody - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ CD207 / Langerin Antibody for IHC, WB/Western LS-B15420 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/23/2024