Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C490301-100 100 µg $435 
HDAC6 Antibody

HDAC6 Antibody LS‑C490301

HDAC6 Antibody LS‑C490301

Rabbit Polyclonal to Human HDAC6
Human, Rat
Unconjugated, Unmodified
Catalog Number
100 µg
Toll Free North America


Rabbit Polyclonal to Human HDAC6
Human, Rat
Unconjugated, Unmodified


HDAC6 antibody LS-C490301 is an unconjugated rabbit polyclonal antibody to HDAC6 from human and rat. Validated for WB.
Human HDAC6
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute in sterile distilled water.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HDAC6
Q9UBN7 NM_006044 NP_006035.2

Publications (0)

Reviews (0)

Featured Products

HDAC6 Antibody - Anti-HDAC6 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Mouse, Human, Rat
Applications: IHC, Western blot
HDAC6 Antibody - Anti-HDAC6 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Monkey, Mouse
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
HDAC6 Antibody - Western blot of HDAC-6 in NIH-3T3 cell lysate with antibody.
Species: Human, Mouse
Applications: Western blot, Immunoprecipitation, Chromatin Immunoprecipitation
Species: Human, Mouse
Applications: Western blot, Immunoprecipitation
HDAC6 Antibody - WB of HDAC6 antibody. All lanes: Anti-HDAC6 at 0.5ug/ml. Lane 1: Rat Brain Tissue Lysate at 40ug. Lane 2: Rat Testis Tissue Lysate at 40ug. Lane 3: HELA Whole Cell Lysate at 40ug. Predicted bind size: 131KD. Observed bind size: 131KD.
Species: Human, Monkey, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot

Requested From: United States
Date Requested: 10/21/2019