Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order

BCAR3 Antibody LS‑C490518

Catalog Number Size Price
LS-C490518-100 100 µg $435 
Immunohistochemistry - Paraffin Image
Immunohistochemistry - Paraffin Image
Immunohistochemistry - Paraffin Image
Western blot Image
Immunohistochemistry - Paraffin Image
Immunohistochemistry - Paraffin Image
Immunohistochemistry - Paraffin Image
Western blot Image
1 of 4
2 of 4
3 of 4
4 of 4

BCAR3 Antibody LS‑C490518

Rabbit Polyclonal to Human BCAR3
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human BCAR3
Human, Mouse, Rat
Unconjugated, Unmodified


BCAR3 antibody LS-C490518 is an unconjugated rabbit polyclonal antibody to BCAR3 from human, mouse and rat. Validated for IHC and WB.
Human BCAR3
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Amino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute in sterile distilled water.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BCAR3
O75815 NM_003567 NP_003558.1

Publications (0)

Reviews (0)

Featured Products

Immunohistochemical analysis of BCAR3 staining in human colon cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Bovine
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA
Anti-BCAR3 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
BCAR3 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
Species: Human, Mouse, Rat, Dog
Applications: IHC, IHC - Paraffin, Western blot
Reactivity: Human
Range: Positive/Negative
Reactivity: Human
Range: 78.13-5000 pg/ml

Requested From: United States
Date Requested: 9/21/2019