Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G11462-10 10 µg $286 
LS-G11462-50 50 µg $472 
LS-G11462-100 100 µg $752 
LS-G11462-200 200 µg $942 
LS-G11462-500 500 µg $1,600 
LS-G11462-1 1 mg $2,069 
LS-G11462-2 2 mg $2,257 
LS-G11462-5 5 mg $3,291 
IL1A / IL-1 Alpha Protein - Recombinant Interleukin 1 Alpha By SDS-PAGE

Rabbit IL1A / IL-1 Alpha Protein (Recombinant His) (aa132-267) - LS-G11462

Rabbit IL1A / IL-1 Alpha Protein (Recombinant His) (aa132-267) - LS-G11462

Description:
IL1A / IL-1 Alpha Protein LS-G11462 is a Recombinant Rabbit IL1A / IL-1 Alpha produced in E. coli aa 132-267 with His tag(s). For Research Use Only
Price
Catalog Number
$286
LS-G11462-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
IL1A / IL-1 Alpha Protein LS-G11462 is a Recombinant Rabbit IL1A / IL-1 Alpha produced in E. coli aa 132-267 with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
IL1A / IL-1 Alpha
Synonyms
IL1A | Hematopoietin-1 | IL-1 alpha | IL1 | IL1-ALPHA | IL1 Alpha | Interleukin-1 alpha | IL-1A | IL1F1 | Pro-interleukin-1-alpha | Preinterleukin 1 alpha | Interleukin 1, alpha
Species
Rabbit
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 132-267
Predicted Molecular Weight
16.9 kDa
AA Sequence
MGHHHHHHSGSEFQEFTLNDALNQSLVRDTSDQYLRAAPLQNLGDAVKFDMG VYMTSEDSILPVTLRISQTPLFVSAQNEDEPVLLKEMPETPRIITDSESDILFFWETQGN KNYFKSAANPQLFIATKPEHLVHMARGLPSMTDFQIS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95%
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from PBS, pH 7.4, 0.01% SKl, 5% Trehalose.
Reconstitution
Reconstitute in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/ml. Do not vortex.
Storage
Store at 4°C for up to 1 month, or aliquot and store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL1A / IL-1 Alpha
P01583 NM_000575 NP_000566.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein - Recombinant Interleukin 1 Alpha By SDS-PAGE
Recombinant Interleukin 1 Alpha By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein - Recombinant Interleukin 1 Alpha By SDS-PAGE
Recombinant Interleukin 1 Alpha By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein - Recombinant Interleukin 1 Alpha By SDS-PAGE
Recombinant Interleukin 1 Alpha By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL1A / IL-1 Alpha Protein - Recombinant Interleukin 1 Alpha By SDS-PAGE
Recombinant Interleukin 1 Alpha By SDS-PAGE

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/1/2024