Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G55775-10 10 µg $281 
LS-G55775-50 50 µg $395 
LS-G55775-500 500 µg $1,585 
LS-G55775-1 1 mg $2,157 
Protein

Human CD207 / Langerin Protein (Recombinant 6His, N-terminus) (Tyr64-Pro328) - LS-G55775

Human CD207 / Langerin Protein (Recombinant 6His, N-terminus) (Tyr64-Pro328) - LS-G55775

Description:
CD207 / Langerin Protein LS-G55775 is a Recombinant Human CD207 / Langerin Tyr64-Pro328 with 6His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$281
LS-G55775-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CD207 / Langerin Protein LS-G55775 is a Recombinant Human CD207 / Langerin Tyr64-Pro328 with 6His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CD207 / Langerin
Synonyms
CD207 | CD207 antigen, langerin | CD207 antigen | CD207 molecule, langerin | CLEC4K | Langerin
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
Tyr64-Pro328
Predicted Molecular Weight
31.5kD
AA Sequence
GSGSHHHHHHIEGRYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile solution in PBS, pH 7.4.
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD207 / Langerin
Q9UJ71 NM_015717 NP_056532.4

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/3/2024