Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G39382-10 10 µg $306 
LS-G39382-50 50 µg $509 
LS-G39382-500 500 µg $1,780 
LS-G39382-1 1 mg $2,848 
Protein

Human TGFBR2 Protein (Recombinant Fc, C-terminus) (Thr23-Asp159) - LS-G39382

Human TGFBR2 Protein (Recombinant Fc, C-terminus) (Thr23-Asp159) - LS-G39382

Description:
TGFBR2 Protein LS-G39382 is a Recombinant Human TGFBR2 produced in Human Cells Thr23-Asp159 with Fc, C-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$306
LS-G39382-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TGFBR2 Protein LS-G39382 is a Recombinant Human TGFBR2 produced in Human Cells Thr23-Asp159 with Fc, C-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
TGFBR2
Synonyms
TGFBR2 | AAT3 | FAA3 | HNPCC6 | LDS2B | MFS2 | TGF-beta receptor type-2 | TGF-beta RII | TGFBRII | TGF-beta type II receptor | TGFbeta-RII | TbetaR-II | TGF beta Receptor II | TGF-beta receptor type II | TGF-beta receptor type IIB | TGFR-2 | LDS1B | RIIC | TAAD2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Fc, C-terminus
Region
Thr23-Asp159
Predicted Molecular Weight
42.6kD
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile solution in 20 mM PB, pH 7.2, 150 mM NaCl
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TGFBR2
P37173 NM_003242 NP_003233.4

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 8/15/2022