Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G39349-10 10 µg $185 
LS-G39349-50 50 µg $225 
LS-G39349-500 500 µg $635 
LS-G39349-1 1 mg $995 
Protein

Human KLRC1 / NKG2A / CD159a Protein (Recombinant 8His, N-terminus) (Arg100-Leu233) - LS-G39349

Human KLRC1 / NKG2A / CD159a Protein (Recombinant 8His, N-terminus) (Arg100-Leu233) - LS-G39349

Description:
KLRC1 / NKG2A / CD159a Protein LS-G39349 is a Recombinant Human KLRC1 / NKG2A / CD159a produced in Human Cells Arg100-Leu233 with 8His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$185 
LS-G39349-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
KLRC1 / NKG2A / CD159a Protein LS-G39349 is a Recombinant Human KLRC1 / NKG2A / CD159a produced in Human Cells Arg100-Leu233 with 8His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
KLRC1 / NKG2A / CD159a
Synonyms
KLRC1 | CD159a antigen | NK cell receptor A | Natural killer cell lectin | NKG2 | NKG2-A | NKG2A | C-lectin type II protein | CD159A | Natural killer group protein 2 | NKG2-B
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
8His, N-terminus
Region
Arg100-Leu233
Predicted Molecular Weight
16.5kD
AA Sequence
HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from Sterile Solution PBS, pH 7.4
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About KLRC1 / NKG2A / CD159a
P26715 NM_002259 NP_002250.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 7/11/2020