Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G141047-50 50 µg (1 mg/ml) $531 
LS-G141047-100 100 µg $756 
LS-G141047-200 200 µg $1,103 
LS-G141047-0.5 0.5 mg $1,475 
LS-G141047-1 1 mg $1,868 
LS-G141047-5 5 mg $3,201 
LS-G141047-10 10 mg $4,268 
Protein

Human ARID1A / BAF250 Protein (Recombinant His) (aa1201-1430) - LS-G141047

Human ARID1A / BAF250 Protein (Recombinant His) (aa1201-1430) - LS-G141047

Description:
ARID1A / BAF250 Protein LS-G141047 is a Recombinant Human ARID1A / BAF250 AA 1201-1430 with His tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$531
LS-G141047-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ARID1A / BAF250 Protein LS-G141047 is a Recombinant Human ARID1A / BAF250 AA 1201-1430 with His tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ARID1A / BAF250
Synonyms
ARID1A | BAF250 | BAF250a | BRG1-associated factor 250a | C1orf4 | BRG1-associated factor 250 | ELD | HOSA1 | Osa homolog 1 | OSA1 | OSA1 nuclear protein | SMARCF1 | MRD14 | p270 | B120 | BM029 | Brain protein 120 | C10rf4 | HELD | SWI-like protein | SWI/SNF complex protein p270
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
AA 1201-1430
Predicted Molecular Weight
25.3 kDa
AA Sequence
KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYN
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 0.1 EU/µg protein (determined by LAL method).
Presentation
50 mM NaH2PO4, pH 8.0, 500 mM NaCl, 500mM Imidazole, 10% glycerol
Storage
Store at -20°C for up to 6 months. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARID1A / BAF250
O14497 NM_006015 NP_006006.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024