Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22945-20 20 µg $354 
LS-G22945-100 100 µg $489 
LS-G22945-500 500 µg $1,080 
GUCA2B / Uroguanylin Protein

Mouse GUCA2B / Uroguanylin Protein (Recombinant His) (aa22-106) - LS-G22945

Mouse GUCA2B / Uroguanylin Protein (Recombinant His) (aa22-106) - LS-G22945

Description:
GUCA2B / Uroguanylin Protein LS-G22945 is a Recombinant Mouse GUCA2B / Uroguanylin produced in Yeast aa 22-106 with His tag(s).
Price
Catalog Number
$354
LS-G22945-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
GUCA2B / Uroguanylin Protein LS-G22945 is a Recombinant Mouse GUCA2B / Uroguanylin produced in Yeast aa 22-106 with His tag(s).

Specifications

Type
Recombinant Protein
Target
GUCA2B / Uroguanylin
Synonyms
GUCA2B | Guanylate cyclase activator 2B | UGN | Uroguanylin | GCAP-II
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 22-106
Predicted Molecular Weight
11.4 kD
AA Sequence
VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GUCA2B / Uroguanylin
Q16661 NM_007102 NP_009033.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GUCA2B / Uroguanylin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GUCA2B / Uroguanylin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GUCA2B / Uroguanylin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GUCA2B / Uroguanylin Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/23/2021