Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G60535-10 10 µg $479 
LS-G60535-25 25 µg $670 
YES1 / c-Yes Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human YES1 / c-Yes Protein (Recombinant GST, N-terminus) (aa1-80) - LS-G60535

Human YES1 / c-Yes Protein (Recombinant GST, N-terminus) (aa1-80) - LS-G60535

Available for shipment within the USA only
Description:
YES1 / c-Yes Protein LS-G60535 is a Recombinant Human YES1 / c-Yes produced in Wheat Germ Extract aa 1-80 with GST, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G60535-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
YES1 / c-Yes Protein LS-G60535 is a Recombinant Human YES1 / c-Yes produced in Wheat Germ Extract aa 1-80 with GST, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
YES1 / c-Yes
Synonyms
YES1 | C-yes | Cyes | Cellular yes-1 protein | HsT441 | Oncogene kinase yes1 | p61-YES | p61yes | p62c-yes | Proto-oncogene c-Yes | Tyrosine-protein kinase Yes | Yes kinase | v-yes | Yes | Yamaguchi sarcoma oncogene
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 1-80
AA Sequence
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About YES1 / c-Yes
P07947 NM_005433 NP_005424.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

YES1 / c-Yes Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

YES1 / c-Yes Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

YES1 / c-Yes Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

YES1 / c-Yes Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024