LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human USP14 Protein (Recombinant 6His,N-terminus) (Asp91-Gln494) - LS-G38723

Catalog Size Price
LS-G38723-10 10 µg Unavailable
LS-G38723-50 50 µg Unavailable
LS-G38723-500 500 µg Unavailable
LS-G38723-1000 1000 µg Unavailable

Most Popular USP14 Proteins

Human USP14 Protein (Recombinant His) - LS-G2138
E. coli Expression System
517 AA
His
Purified
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human USP14 Protein (Recombinant His) - LS-G18562
E. coli Expression System
His
Purified
Human USP14 Protein (Recombinant His) (Full Length) - LS-G21312
E. coli Expression System
494 AA
His
Human USP14 Protein (Recombinant His) (aa1-494) - LS-G25557
E. coli Expression System
His
Lyophilized
Human USP14 Protein (Recombinant GST) (Full Length) - LS-G31475
Wheat Wheat Germ Extract
494 AA
GST
Purified
12.5% SDS-PAGE of human USP14 stained with Coomassie Blue

100% Guaranteed
LS-G38723
Recombinant Protein
USP14
Human
48.45kD
Recombinant Human USP14 is produced by our E. coli expression system and the target gene encoding Asp91-Gln494 is expressed with a 6His tag at the N-terminus.
Asp91-Gln494
MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
E. coli
E. coli
6His,N-terminus
Greater than 95% by SDS-PAGE
Not Tested
Less than 1.0 EU/µg protein (determined by LAL method).
Supplied as 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 100 mM NaCl, 20% Glycerol.
Store at less than -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
For research use only.

About USP14

P54578 NM_005151 NP_005142.1

USP14 Protein, Deubiquitinating enzyme 14 Protein, Ubiquitin thioesterase 14 Protein, Ubiquitin thiolesterase 14 Protein, TGT Protein, TRNA-guanine transglycosylase Protein, Ubiquitin specific protease 14 Protein

Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis.

Requested From: 
Date Requested: 6/24/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number