Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G55736-10 10 µg $236 
LS-G55736-50 50 µg $285 
LS-G55736-500 500 µg $648 
LS-G55736-1 1 mg $971 
Protein

Human TNFRSF14 / CD270 / HVEM Protein (Recombinant His, C-Terminal) (Leu39-Val202) - LS-G55736

Human TNFRSF14 / CD270 / HVEM Protein (Recombinant His, C-Terminal) (Leu39-Val202) - LS-G55736

Description:
TNFRSF14 / CD270 / HVEM Protein LS-G55736 is a Recombinant Human TNFRSF14 / CD270 / HVEM Leu39-Val202 with His, C-Terminal tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method).
Price
Catalog Number
$236
LS-G55736-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TNFRSF14 / CD270 / HVEM Protein LS-G55736 is a Recombinant Human TNFRSF14 / CD270 / HVEM Leu39-Val202 with His, C-Terminal tag(s). It is low in endotoxin; Less than 0.1 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
TNFRSF14 / CD270 / HVEM
Synonyms
TNFRSF14 | CD270 | CD270 antigen | CD40-like protein | Herpesvirus entry mediator | Herpesvirus entry mediator A | HVEM | LIGHTR | Herpes virus entry mediator A | TR2 | ATAR | HVEA
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His, C-Terminal
Region
Leu39-Val202
Predicted Molecular Weight
18.38kD
AA Sequence
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVVDHHHHHH
Source Species
Human
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 0.1 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile solution in 20 mM PB, pH 7.2, 150 mM NaCl
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Store at less than -20°C. After reconstitution store at 4-7°C for up to 1 week. Aliquots of reconstituted samples can be stored at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNFRSF14 / CD270 / HVEM
Q92956 NM_003820 NP_003811.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021