LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human TGFB1 / TGF Beta 1 Protein (Recombinant Human IgG4 Fc) - LS-G4063

Catalog
Size
Price
LS-G4063-100
100 µg
$435
Description
TGFB1 / TGF Beta 1 Protein LS-G4063 is Recombinant Human TGFB1 / TGF Beta 1 in Hamster-Chinese with Human IgG4 Fc tag(s). It is biologically active and is low in endotoxin Less than 0.06 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
TGFB1 / TGF Beta 1
Species
Human
Predicted Molecular Weight
67 kDa
Details
The extracellular domain of a mutant human TGFbeta1 is fused to the N-terminus of the Fc region of human IgG4. Site-directed mutagenesis was used to change three cysteine codons into a serine codon that are located in the pro region of the TGF-beta precursor at positions 33, 223, and 225.
AA Sequence
LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTH
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 98% by SDS-PAGE
Bio-Activity
Shows the biological function of the TGFbeta1 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.
Endotoxin
Less than 0.06 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
Reconstitute in 100 ul sterile water
Storage
Store lyophilized at -20°C for up to 1 year. Once reconstituted store at 4°C for immediate use, or aliquot and store at -20°C for up to 3 months. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About TGFB1 / TGF Beta 1
P01137 NM_000660 NP_000651.3

Popular TGFB1 / TGF Beta 1 Proteins

Inhibition Image
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: Human Human Cells
Tag: None
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy