Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G19929-5 5 µg $236 
Protein

Human SERPINA1 / Alpha 1 Antitrypsin Protein (Recombinant) - LS-G19929

Human SERPINA1 / Alpha 1 Antitrypsin Protein (Recombinant) - LS-G19929

Description:
SERPINA1 / Alpha 1 Antitrypsin Protein LS-G19929 is a Recombinant Human SERPINA1 / Alpha 1 Antitrypsin produced in E. coli aa25-418.
Price
Catalog Number
$236
LS-G19929-5
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
SERPINA1 / Alpha 1 Antitrypsin Protein LS-G19929 is a Recombinant Human SERPINA1 / Alpha 1 Antitrypsin produced in E. coli aa25-418.

Specifications

Type
Recombinant Protein
Target
SERPINA1 / Alpha 1 Antitrypsin
Synonyms
SERPINA1 | A1A | A1AT | AAT | Alpha 1 Antitrypsin | Alpha-1 protease inhibitor | Alpha-1-antiproteinase | Alpha-1-antitrypsin | Alpha1AT | PRO2275 | Alpha-1-antitrypsin null | PI1 | Serpin A1 | Alpha 1 AT
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
aa25-418
Predicted Molecular Weight
44.4 kDa
AA Sequence
MEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 7.5, 2 mM EDTA, 1 mM DTT, 10% Glycerol
Storage
Store at 4°C short term. Store at -20°C long term. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SERPINA1 / Alpha 1 Antitrypsin
P01009 K02212 AAB59495.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021