Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G59486-10 10 µg $479 
LS-G59486-25 25 µg $670 
P2RX3 / P2X3 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human P2RX3 / P2X3 Protein (Recombinant GST, N-terminus) (aa45-154) - LS-G59486

Human P2RX3 / P2X3 Protein (Recombinant GST, N-terminus) (aa45-154) - LS-G59486

Available for shipment within the USA only
Description:
P2RX3 / P2X3 Protein LS-G59486 is a Recombinant Human P2RX3 / P2X3 produced in Wheat Germ Extract aa 45-154 with GST, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G59486-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
P2RX3 / P2X3 Protein LS-G59486 is a Recombinant Human P2RX3 / P2X3 produced in Wheat Germ Extract aa 45-154 with GST, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
P2RX3 / P2X3
Synonyms
P2RX3 | ATP receptor | p2X3 | p2X3 purinoceptor | p2X purinoceptor 3 | Purinergic receptor P2X3 | Purinoceptor P2X3 | Purinergic receptor | p2RX3 | p2X receptor 3 | p2X receptor, subunit 3
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 45-154
AA Sequence
HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCP
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About P2RX3 / P2X3
P56373 NM_002559 NP_002550.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RX3 / P2X3 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RX3 / P2X3 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RX3 / P2X3 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RX3 / P2X3 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2024