LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human MMP1 Protein (Recombinant) - LS-G430

Best Seller
Catalog
Size
Price
LS-G430-2
2 µg
$215
LS-G430-10
10 µg
$285
Description
MMP1 Protein LS-G430 is Recombinant Human MMP1 in E. coli It is biologically active and is low in endotoxin Less than 0.1 ng/µg of protein (less than 1EU/µg)..
Type
Recombinant Protein
Target
MMP1
Species
Human
Predicted Molecular Weight
42.7 kDa
AA Sequence
MFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE and HPLC
Bio-Activity
MMP-1 activity was measured by its ability to cleave a chromogenic peptide MMP-1 substrate at room temperature. At an MMP-1 concentration of 2.5 ug/ml, 50% cleavage was achieved at an incubation time of approximately 25 minutes.
Endotoxin
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
Sterile filtered, lyophilized from 20 mM Tris, pH 9.0, 0.1 mM calcium chloride, 100 mM Arginine
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5-1.0 mg/ml. Note: Slow to dissolve. Gently shake the solution for about 10 minutes for better solubility. Do not vortex. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About MMP1
P03956 NM_002421 NP_002412.1

Popular MMP1 Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: His
Format: Purified
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: Human HEK 293 Cells
Tag: His
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.
Recombinant Matrix Metalloproteinase 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 6/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy