Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G59745-10 10 µg $479 
LS-G59745-25 25 µg $670 
MAPK7 / ERK5 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human MAPK7 / ERK5 Protein (Recombinant GST, N-terminus) (aa561-677) - LS-G59745

Human MAPK7 / ERK5 Protein (Recombinant GST, N-terminus) (aa561-677) - LS-G59745

Available for shipment within the USA only
Description:
MAPK7 / ERK5 Protein LS-G59745 is a Recombinant Human MAPK7 / ERK5 produced in Wheat Germ Extract aa 561-677 with GST, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G59745-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
MAPK7 / ERK5 Protein LS-G59745 is a Recombinant Human MAPK7 / ERK5 produced in Wheat Germ Extract aa 561-677 with GST, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
MAPK7 / ERK5
Synonyms
MAPK7 | Big MAP kinase 1 | BMK-1 | Erk4 | ERK5 | MAPK 7 | PRKM7 | BMK1 | BMK1 kinase | ERK-5 | MAP kinase 7
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 561-677
AA Sequence
PQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MAPK7 / ERK5
Q13164 NM_002749 NP_002740.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK7 / ERK5 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK7 / ERK5 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK7 / ERK5 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK7 / ERK5 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2024