Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G12164-10 10 µg $277 
LS-G12164-50 50 µg $417 
LS-G12164-100 100 µg $667 
LS-G12164-200 200 µg $832 
LS-G12164-500 500 µg $1,470 
LS-G12164-1 1 mg $1,922 
LS-G12164-2 2 mg $2,107 
LS-G12164-5 5 mg $2,913 
EMA / MUC1 Protein - Recombinant Mucin 1 By SDS-PAGE

Human EMA / MUC1 Protein (Recombinant His, N-Terminal) (aa1034-1151) - LS-G12164

Human EMA / MUC1 Protein (Recombinant His, N-Terminal) (aa1034-1151) - LS-G12164

Description:
EMA / MUC1 Protein LS-G12164 is a Recombinant Human EMA / MUC1 produced in E. coli aa 1034-1151 with His, N-Terminal tag(s). For Research Use Only
Price
Catalog Number
$277
LS-G12164-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
EMA / MUC1 Protein LS-G12164 is a Recombinant Human EMA / MUC1 produced in E. coli aa 1034-1151 with His, N-Terminal tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
EMA / MUC1
Synonyms
MUC1 | CA15-3 | CD227 | Carcinoma-associated mucin | CD227 antigen | DF3 antigen | Episialin | Epithelial membrane antigen | H23 antigen | H23AG | Krebs von den Lungen-6 | MAM6 | MUC1/ZD | MUC-1/SEC | Mucin-1 | Pem | KL-6 | MUC-1/X | Tumor-associated mucin | Peanut-reactive urinary mucin | Polymorphic epithelial mucin | PUM | EMA | MUC-1 | Mucin 1, transmembrane
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His, N-Terminal
Region
aa 1034-1151
Predicted Molecular Weight
17.2 kDa
AA Sequence
PQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95%
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 20mM Tris, 150mM NaCl, pH8.0, containing 1 mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Reconstitution
Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/ml. Do not vortex.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About EMA / MUC1
P15941 NM_002456 NP_002447.4

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EMA / MUC1 Protein - Recombinant Mucin 1 By SDS-PAGE
Recombinant Mucin 1 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EMA / MUC1 Protein - Recombinant Mucin 1 By SDS-PAGE
Recombinant Mucin 1 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EMA / MUC1 Protein - Recombinant Mucin 1 By SDS-PAGE
Recombinant Mucin 1 By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EMA / MUC1 Protein - Recombinant Mucin 1 By SDS-PAGE
Recombinant Mucin 1 By SDS-PAGE

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/24/2024