Recombinant Protein

CD86

Human

Unmodified. Also available Preservative Free.

52.2 kDa

CHO Cells

Hamster-Chinese

A soluble fusion protein consisting of the extracellular (224 aa) domain of human CD86 fused to murine IgG2a Fc region. This molecules contains 1 amino acid polymorphism when compared to Genebank sequence HUMB72A. This residue has not been implicated in the CD86-CD152 binding site. CD86 EC (224 aa): (1)aplkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgrtsfdsdswtlrlhnlqikdkglyqcii(90)rhkkptg(97)virihqmnselsvlanfsqpeivpisnitenvyinltcssihgypepkkmsvllrtknstieydgv(162)mqksqdnvtelydvsislsvsfpdvtsnmtifciletdktrllsspfsieledpqpppdhip, linker (2 aa): gt, Murine IgG2a Fc +Hinge (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg. Predicted monomeric molecular weight: 52.2 kd. The molecule is dimeric and runs at about 115 kd in SDS-PAGE under native conditions. CD86(P2)-muIg was reactive in an Enzyme Immuno Assay utilizing a Goat anti-Mouse Ig coated plate for capture and either CD152-muIg/Biotin recombinant protein or anti-CD86/Biotin followed by Streptavidin/HRP and TMB/H2O2 substrate chromagen for detection. CD86(p2)-muIg bound in FACS to cell surface CD28 present on cultured human T cell leukemic line HPB-MLT. Five x 10^5 cells per tube were washed and incubated 45 minutes on ice with 80 µl of CD86(P2)-muIg at 10 µg/ml. Cells were washed twice and incubated with secondary reagent Goat anti-Mouse IgG/FITC, after which they were washed three times, fixed and analyzed by FACS. Cells stained positive with a mean shift of 0.52 log10 fluorescent units when compared to a recombinant muIg Fc negative control at a similar concentration.

Not Tested

Not Tested

50 mM Sodium Phosphate, pH 7.5, 150 mM NaCl, 100 mM KCl, 0.5 mg/ml Gentamicin Sulfate

Store at 2°C to 5°C for up to 1 year. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This protein carries the LSBio 100% Guarantee.

Uniprot: P42081 NCBI: NM_006889 NP_008820.3