Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G68292-20 20 µg (0.06 mg/ml) $1,107 
BBC3 / PUMA Protein - Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Human BBC3 / PUMA Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G68292

Human BBC3 / PUMA Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G68292

Available for shipment within the USA only
Description:
BBC3 / PUMA Protein LS-G68292 is a Recombinant Human BBC3 / PUMA produced in HEK 293 Cells with Myc-DDK (Flag) tag(s). For Research Use Only
Price
Catalog Number
$1,107
LS-G68292-20

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
BBC3 / PUMA Protein LS-G68292 is a Recombinant Human BBC3 / PUMA produced in HEK 293 Cells with Myc-DDK (Flag) tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
BBC3 / PUMA
Synonyms
BBC3 | Bcl-2-binding component 3 | BCL2 binding component 3 | JFY-1 | JFY1 | PUMA | PUMA alpha
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
20.4 kDa
AA Sequence
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About BBC3 / PUMA
Q9BXH1 NM_014417 NP_055232.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BBC3 / PUMA Protein - Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BBC3 / PUMA Protein - Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BBC3 / PUMA Protein - Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

BBC3 / PUMA Protein - Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein BBC3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/3/2024