LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Cynomolgus monkey TNFSF4 / OX40L Protein (Recombinant 8His,N-terminus) (Gln51-Leu183) - LS-G40304

Catalog Size Price
LS-G40304-10 10 µg Unavailable
LS-G40304-50 50 µg Unavailable
LS-G40304-500 500 µg Unavailable
LS-G40304-1000 1000 µg Unavailable

Most Popular TNFSF4 / OX40L Proteins

Human TNFSF4 / OX40L Protein (Recombinant) - LS-G353
Trichoplusia ni High Five Cells
133 AA
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Mouse TNFSF4 / OX40L Protein (Recombinant DDK + human ACRP30headless aa 18-111) (aa52-199) - LS-G3891
Human HEK 293 Cells
DDK + human ACRP30headless aa 18-111
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.01 EU/µg protein (determined by LAL method).
Human TNFSF4 / OX40L Protein (Recombinant 6His,N-terminus) (Gln51-Leu183) - LS-G40005
Human Human Cells
139 AA
6His,N-terminus
Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Mouse TNFSF4 / OX40L Protein (Recombinant 8His,N-terminus) (Ser51-Leu198) - LS-G40217
Human Human Cells
156 AA
8His,N-terminus
Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Cynomolgus monkey TNFSF4 / OX40L Protein (Recombinant 8His,N-terminus) (Gln51-Leu183) - LS-G40304
Human Human Cells
141 AA
8His,N-terminus
Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).

100% Guaranteed
LS-G40304
Recombinant Protein
TNFSF4 / OX40L
Cynomolgus monkey
16.5kD
Recombinant Cynomolgus monkey OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 8His tag at the N-terminus.
Gln51-Leu183
HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Human Cells
Human
8His,N-terminus
Greater than 95% by SDS-PAGE
Not Tested
Less than 1.0 EU/µg protein (determined by LAL method).
Lyophilized from 0.2 µm filtered PBS, pH 7.4.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
For research use only.

About TNFSF4 / OX40L

P23510 NM_003326 NP_003317.1

TNFSF4 Protein, CD134 ligand Protein, CD134L Protein, CD252 antigen Protein, Glycoprotein Gp34 Protein, OX-40L Protein, OX40 ligand Protein, TXGP1 Protein, OX40L Protein, OX4OL Protein, CD252 Protein, gp34 Protein, OX40 antigen ligand Protein

TNFSF4 / OX40L is a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.

Requested From: 
Date Requested: 6/24/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number