Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C345901-100 100 µl (0.5 mg/ml) $365 
Zfp566 Antibody - Western blot of Zfp566 Antibody - middle region in Rat Spleen cells lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.

Zfp566 Antibody (Internal) LS‑C345901

Zfp566 Antibody (Internal) LS‑C345901

Rabbit Polyclonal to Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse
Unconjugated, Unmodified
Other formats:
Catalog Number
100 µl
0.5 mg/ml
Toll Free North America


Rabbit Polyclonal to Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse
Unconjugated, Unmodified
Other formats:


Zfp566 antibody LS-C345901 is an unconjugated rabbit polyclonal antibody to Zfp566 from human, mouse, rat and other species. Validated for WB.
Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse (tested or 100% immunogen sequence identity)
Unconjugated. Also available conjugated with Biotin, FITC, HRP.
Immunoaffinity purified
  • Western blot
  • Applications tested for the base form of this product only
The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Percent identity by BLAST analysis: Rat, Horse, Human, Mouse (100%); Dog, Pig, Bovine, Rabbit, Zebrafish (93%); Guinea pig (86%).
Rat Zpf566
PBS, 0.09% sodium azide, 2% sucrose
Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Zfp566

Publications (0)

Reviews (0)

Featured Products

Zfp566 Antibody - Western blot of Zfp566 Antibody - middle region in Rat Spleen cells lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat, Human, Mouse, Guinea pig, Horse
Applications: Western blot
Zfp566 Antibody - Western blot of Zfp566 Antibody - middle region in Rat Spleen cells lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat, Human, Mouse, Guinea pig, Horse
Applications: Western blot
Zfp566 Antibody - Western blot of Zfp566 Antibody - middle region in Rat Spleen cells lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat, Human, Mouse, Guinea pig, Horse
Applications: Western blot
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Flow Cytometry, ELISA
Reactivity: Rat
Range: 0.625-40 ng/ml

Requested From: United States
Date Requested: 10/15/2019