Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C464524-100 100 µl (1 mg/ml) $385 
Zfp566 Antibody - Western blot of Zfp566 Antibody - middle region in Rat Spleen cells lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.

Polyclonal Rabbit anti‑Rat Zfp566 Antibody (Biotin, Internal, WB) LS‑C464524

Polyclonal Rabbit anti‑Rat Zfp566 Antibody (Biotin, Internal, WB) LS‑C464524

Rabbit Polyclonal to Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse
Biotin, Unmodified
Other formats:
Catalog Number
100 µl
1 mg/ml
Toll Free North America
For Research Use Only


Rabbit Polyclonal to Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse
Biotin, Unmodified
Other formats:


Zfp566 antibody LS-C464524 is a biotin-conjugated rabbit polyclonal antibody to Zfp566 (Internal) from rat. It is reactive with human, mouse, rat and other species. Validated for WB.
Rat Zfp566
Rat, Human, Mouse, Guinea pig, Horse (tested or 100% immunogen sequence identity)
Biotin. Also available Unconjugated or conjugated with FITC, HRP.
Immunoaffinity purified
  • Western blot
  • Applications tested for the base form of this product only
Synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Percent identity by BLAST analysis: Rat, Horse, Human, Mouse (100%); Dog, Pig, Bovine, Rabbit, Zebrafish (93%); Guinea pig (86%).
Rat Zfp566
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Zfp566

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 8/5/2020