Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

UBE2L6 Antibody LS-C748706

Western blot analysis of extracts of various cell lines, using UBE2L6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

UBE2L6 Antibody LS-C748706

Rabbit Polyclonal to Human UBE2L6
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human UBE2L6
Human, Mouse, Rat
Unconjugated, Unmodified


UBE2L6 antibody LS-C748706 is an unconjugated rabbit polyclonal antibody to UBE2L6 from human, mouse and rat. Validated for WB.

Human UBE2L6
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
UBE2L6 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human UBE2L6 (NP_004214.1). AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
The predicted MW is 10kDa/17kDa, while the observed MW by Western blot was 18kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About UBE2L6
O14933 NM_004223 NP_004214.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Mouse
Range: 15.6-1000 pg/ml
Reactivity: Rat
Range: 6.25-400 ng/ml
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemical analysis of EGR1 staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat, Bovine, Chicken
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot

Requested From: United States
Date Requested: 6/20/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy