Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

TRPC6 Antibody LS-C409691

TRPC6 antibody LS-C409691 is an unconjugated rabbit polyclonal antibody to TRPC6 from human, mouse and rat. Validated for WB.
50 µl
100 µl
200 µl
TRPC6 antibody LS-C409691 is an unconjugated rabbit polyclonal antibody to TRPC6 from human, mouse and rat. Validated for WB.
Human TRPC6
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
TRPC6 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC6 (NP_004612.2). SWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
Human TRPC6
The predicted MW is 93kDa/100kDa/106kDa, while the observed MW by Western blot was 110kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About TRPC6
Q9Y210 NM_004621 NP_004612.2

Popular TRPC6 Products

Anti-TRPC6 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry of TRPC6 in mouse lung tissue with TRPC6 antibody at 10 ug/ml.
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, ELISA
TRPC6 antibody. IHC(P): Rat Brain Tissue.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Species: Zebrafish
Applications: IHC, Western blot
TRPC6 antibody Western blot of MCF7 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat, Pig
Applications: Western blot

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Requested From: United States
Date Requested: 3/24/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy