LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

TRPC6 Antibody LS-C409691

Western blot analysis of extract of various cells.

TRPC6 Antibody LS-C409691

Antibody:
Rabbit Polyclonal to Human TRPC6
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$255 
LS-C409691-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human TRPC6
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TRPC6 antibody LS-C409691 is an unconjugated rabbit polyclonal antibody to TRPC6 from human, mouse and rat. Validated for WB.

Target
Human TRPC6
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
TRPC6 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC6 (NP_004612.2). SWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
Specificity
Human TRPC6
Usage
The predicted MW is 93kDa/100kDa/106kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TRPC6
Q9Y210 NM_004621 NP_004612.2

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 0.156-10 ng/ml
Product
Species: Virus
Applications: Neutralization
Reactivity: Rat
Range: 7.8-500 pg/ml
Product
Species: Human
Applications: ICC, Western blot, Flow Cytometry, ELISA

Requested From: United States
Date Requested: 7/18/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy