LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
TRAF3 Antibody LS‑C331139
TRAF3 antibody LS-C331139 is an unconjugated rabbit polyclonal antibody to TRAF3 from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C331139-50
50 µl
$235
LS-C331139-100
100 µl
$295
LS-C331139-200
200 µl
$385

Popular TRAF3 Products

Anti-TRAF3 antibody IHC of human brain. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B609 concentration 5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
Anti-TRAF3 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1428 concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Western blot
Anti-TRAF3 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6511 concentration 10 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
Western blot of TRAF3 in various tumor cell lines using LS-C148300 at 1:2000. TRAF3 is observed at ~67 kD.
Species: Human, Mouse, Rat, Gerbil
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation
Immunofluorescent analysis of TRAF3 staining in HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with the primary antibody in 3% BSA-PBS and incubated overnight at 4 C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight 594-conjugated secondary antibody (red) in PBS at room temperature in the dark. DAPI was used to stain the cell nuclei (blue).
Species: Human, Mouse, Rat, Pig, Sheep
Applications: ICC, Immunofluorescence, Western blot

Product Description

TRAF3 antibody LS-C331139 is an unconjugated rabbit polyclonal antibody to TRAF3 from human, mouse and rat. Validated for WB.
About TRAF3
Regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of B-cell survival. Part of signaling pathways leading to the production of cytokines and interferon. Required for normal antibody isotype switching from IgM to IgG. Plays a role T-cell dependent immune responses. Plays a role in the regulation of antiviral responses. Is an essential constituent of several E3 ubiquitin-protein ligase complexes. Q13114 NM_145725 NP_663777.1

TRAF3 Antibody, CAP-1 Antibody, CD40 associated protein 1 Antibody, CD40 binding protein Antibody, CRAF1 Antibody, LMP1 Antibody, LMP1-associated protein 1 Antibody, IIAE5 Antibody, CD40-binding protein Antibody, CD40bp Antibody, LAP1 Antibody


Specifications

Target
Human TRAF3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot
Immunogen
TRAF3 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAF3 (NP_003291.2). MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV
Specificity
Human LMP1 / TRAF3
Usage
The predicted MW is 55kDa/64kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.
Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.
Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.
Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using TRAF3 antibodyat dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.
Western blot analysis of extracts of Raji cells lines, using TRAF3 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRAF3 antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 8/17/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy