Research Areas
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us


Orders Processing,
Shipping & Receiving,

2 Shaker Rd Suites
Shirley, MA 01464

Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us

Additional Contact Details

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C746780-20 20 µl $275 
LS-C746780-50 50 µl $311 
LS-C746780-100 100 µl $389 
LS-C746780-200 200 µl $503 
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Western blot analysis of extracts of various cell lines, using SUMO2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Immunohistochemistry of paraffin-embedded rat lung using SUMO2 antibody at dilution of 1:100 (40x lens).
SUMO2 Antibody - Western blot analysis of extracts of various cell lines, using SUMO2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human SUMO2 Antibody (IHC, WB) LS‑C746780

Polyclonal Rabbit anti‑Human SUMO2 Antibody (IHC, WB) LS‑C746780

SUMO2 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


SUMO2 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


SUMO2 antibody LS-C746780 is an unconjugated rabbit polyclonal antibody to SUMO2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Human SUMO2
SUMO2 | HSMT3 | SMT3 homolog 2 | SMT3A | Sentrin 2 | Smt3B | SMT3H2 | SUMO-2 | SUMO-3 | Sentrin-2 | Ubiquitin-like protein SMT3A | Ubiquitin-like protein SMT3B
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 8kDa/10kDa, while the observed MW by Western blot was 16kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SUMO2
P61956 NM_006937 NP_008868.3

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 2/21/2024