Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C747090-20 20 µl $263 
LS-C747090-50 50 µl $301 
LS-C747090-100 100 µl $359 
LS-C747090-200 200 µl $473 
SRC Antibody - Immunohistochemistry of paraffin-embedded human placenta using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Western blot analysis of extracts of various cell lines, using SRC antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
SRC Antibody - Immunohistochemistry of paraffin-embedded human placenta using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using SRC antibody at dilution of 1:100 (40x lens).
SRC Antibody - Western blot analysis of extracts of various cell lines, using SRC antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human SRC Antibody (IHC, WB) LS‑C747090

Polyclonal Rabbit anti‑Human SRC Antibody (IHC, WB) LS‑C747090

SRC Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


SRC Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


SRC antibody LS-C747090 is an unconjugated rabbit polyclonal antibody to SRC from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Human SRC
SRC | ASV | Pp60c-src | Tyrosine kinase pp60c-src | Tyrosine-protein kinase SRC-1 | v-src | C-SRC | p60-Src | Proto-oncogene c-Src | SRC1
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SRC (NP_005408.1). MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAG
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 59kDa/60kDa, while the observed MW by Western blot was 60kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SRC
P12931 NM_005417 NP_005408.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 10/4/2022