LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
SPRING / TRIM9 Antibody LS‑C748917
TRIM9 antibody LS-C748917 is an unconjugated rabbit polyclonal antibody to TRIM9 (SPRING) from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C748917-50
50 µl
$235

Popular SPRING / TRIM9 Products

Anti-TRIM9 antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
A: Marker, B: HepG2 Cell Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Western blot
Anti-TRIM9 mouse monoclonal antibody immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY TRIM9.
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Anti-TRIM9 mouse monoclonal antibody immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY TRIM9.
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Anti-TRIM9 mouse monoclonal antibody immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY TRIM9.
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry

Product Description

TRIM9 antibody LS-C748917 is an unconjugated rabbit polyclonal antibody to TRIM9 (SPRING) from human, mouse and rat. Validated for WB.

Specifications

Target
Human SPRING / TRIM9
Synonyms
TRIM9, KIAA0282, RING finger protein 91, SPRING, Tripartite motif containing 9, RNF91, Tripartite motif-containing 9
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
SPRING / TRIM9 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TRIM9 (NP_055978.4). MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
Usage
The predicted MW is 61kDa/79kDa/89kDa, while the observed MW by Western blot was 79kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About SPRING / TRIM9
E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions and may also participate in the formation or breakdown of abnormal inclusions in neurodegenerative disorders. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation. Q9C026 NM_015163 NP_055978.4


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using TRIM9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 11/16/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy