Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C747430-20 20 µl $253 
LS-C747430-50 50 µl $279 
LS-C747430-100 100 µl $333 
LS-C747430-200 200 µl $429 

Polyclonal Rabbit anti‑Human SNAI1 / SNAIL‑1 Antibody (IHC) LS‑C747430

Polyclonal Rabbit anti‑Human SNAI1 / SNAIL‑1 Antibody (IHC) LS‑C747430

SNAI1 / SNAIL-1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


SNAI1 / SNAIL-1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


SNAIL-1 antibody LS-C747430 is an unconjugated rabbit polyclonal antibody to SNAIL-1 (SNAI1) from human. It is reactive with human, mouse and rat. Validated for IHC.
Human SNAI1 / SNAIL-1
SNAI1 | DJ710H13.1 | Protein sna | SNAIL | Snail 1 | Snail 1, zinc finger protein | Snail homolog 1 (Drosophila) | SNA | Snail 1 homolog | Protein snail homolog 1 | SNAH | Snail 1 zinc finger protein | Zinc finger protein SNAI1 | SLUGH2 | SNAIL1
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human SNAI1 (NP_005976.2). RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
  • IHC (1:50 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 29kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SNAI1 / SNAIL-1
O95863 NM_005985 NP_005976.2

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 1/26/2022