Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C747430-20 20 µl $253 
LS-C747430-50 50 µl $279 
LS-C747430-100 100 µl $333 
LS-C747430-200 200 µl $429 
Antibody

Polyclonal Rabbit anti‑Human SNAI1 / SNAIL‑1 Antibody (IHC) LS‑C747430

Polyclonal Rabbit anti‑Human SNAI1 / SNAIL‑1 Antibody (IHC) LS‑C747430

Antibody:
SNAI1 / SNAIL-1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C747430-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
SNAI1 / SNAIL-1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
SNAIL-1 antibody LS-C747430 is an unconjugated rabbit polyclonal antibody to SNAIL-1 (SNAI1) from human. It is reactive with human, mouse and rat. Validated for IHC.
Target
Human SNAI1 / SNAIL-1
Synonyms
SNAI1 | DJ710H13.1 | Protein sna | SNAIL | Snail 1 | Snail 1, zinc finger protein | Snail homolog 1 (Drosophila) | SNA | Snail 1 homolog | Protein snail homolog 1 | SNAH | Snail 1 zinc finger protein | Zinc finger protein SNAI1 | SLUGH2 | SNAIL1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human SNAI1 (NP_005976.2). RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Applications
  • IHC (1:50 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 29kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SNAI1 / SNAIL-1
O95863 NM_005985 NP_005976.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/24/2022