Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > SMN1 > LS-C756665
 
Print Page  
Catalog Number Size Price
LS-C756665-10 10 µg $318 
LS-C756665-100 100 µg $470 
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - Western blot analysis of SMN1/2 using anti-SMN1/2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human placenta tissue lysates, Lane 3: human SW620 whole cell lysates, Lane 4: human PANC-1 whole cell lysates, Lane 5: human HepG2 whole cell lysates, Lane 6: human A549 whole cell lysates, Lane 7: rat RH35 whole cell lysates, Lane 8: mouse HEPA1-6 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-SMN1/2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - IHC analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-SMN1/2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMN1 Antibody - Western blot analysis of SMN1/2 using anti-SMN1/2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human placenta tissue lysates, Lane 3: human SW620 whole cell lysates, Lane 4: human PANC-1 whole cell lysates, Lane 5: human HepG2 whole cell lysates, Lane 6: human A549 whole cell lysates, Lane 7: rat RH35 whole cell lysates, Lane 8: mouse HEPA1-6 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-SMN1/2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
1 of 4
2 of 4
3 of 4
4 of 4

Monoclonal Mouse anti‑Human SMN1 Antibody (IHC, WB) LS‑C756665

Monoclonal Mouse anti‑Human SMN1 Antibody (IHC, WB) LS‑C756665

Submit Review LSBio Guarantee
Antibody:
SMN1 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756665-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
SMN1 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
SMN1 antibody LS-C756665 is an unconjugated mouse monoclonal antibody to human SMN1. Validated for ICC, IHC and WB.
Target
Human SMN1
Synonyms
SMN1 | BCD541 | Component of gems 1 | Gemin-1 | SMA2 | SMA4 | SMA@ | SMA1 | SMNC | SMNT | T-BCD541 | SMN | Survival motor neuron protein | Gemin 1 | GEMIN1 | SMA | SMA3
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human SMN1/2(22-52 aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SMN1
NM_000344 NP_000335.1

Publications (0)

Submit a Publication for LS-C756665

Customer Reviews (0)

Submit a review for LS-C756665

Featured Products

Product
SMN1 Antibody LS‑C91862
Species: Human, Mouse, Xenopus
Applications: Immunofluorescence, Western blot, Immunoprecipitation, ELISA
SMN1 Antibody - IHC of paraffin-embedded stomach cancer tissues (left) and brain tumor (right) using SMN1 mouse monoclonal antibody with DAB staining.
SMN1 Antibody (clone 5H1) LS‑C169372
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
SMN1 Antibody - Immunocytochemistry of SMN / SMA antibody.
SMN1 Antibody (clone 2B1) LS‑C82216
Species: Human, Mouse, Xenopus
Applications: ICC, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
SMN1 Antibody - SMN1 Antibody western blot of 293 cell line lysates (35 ug/lane). The SMN1 antibody detected the SMN1 protein (arrow).
SMN1 Antibody (aa262‑288) LS‑C159042
Species: Human
Applications: Western blot
SMN1 Antibody - This image was taken for the unconjugated form of this product. Other forms have not been tested.
SMN1 Antibody (C‑Terminus) LS‑C169737
Species: Human
Applications: Western blot
SMN1 Antibody - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
PathPlus™ SMN1 Antibody (aa45‑94) LS‑B5701
Species: Human, Mouse
Applications: IHC - Paraffin, Western blot
See all SMN1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/26/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com