LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
SEPT7 / Septin 7 Antibody LS‑C335403
Septin 7 antibody LS-C335403 is an unconjugated rabbit polyclonal antibody to Septin 7 (SEPT7) from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C335403-50
50 µl
$235
LS-C335403-100
100 µl
$295
LS-C335403-200
200 µl
$385

Popular SEPT7 / Septin 7 Products

Antibody
Species: Yeast
Applications: IHC, Western blot
Anti-SEPT7 / Septin 7 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B9870 dilution 1:100.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Western blot of Septin 7 antibody
Species: Human, Mouse, Rat
Applications: IHC, ICC, Western blot, ELISA
Immunohistochemical analysis of Septin 7 staining in human lung cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat, Bovine
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Chicken
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation

Product Description

SEPT7 / Septin 7 Antibody for WB/Western LS-C335403

Specifications

Target
Human SEPT7 / Septin 7
Synonyms
SEPT7, CDC10, CDC10 protein homolog, Hcdc10, NBLA02942, Sep7, SEPT7A, Septin 7, Septin-7, CDC3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 307-436 of human SEPT7 (NP_001011553.2). NYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
Specificity
Human SEPT7 / Septin 7
Usage
The predicted MW is 50kDa, while the observed MW by Western blot was 51kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
About SEPT7 / Septin 7
SEPT7 / Septin 7 is a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Q16181 NM_001788 NP_001779.3


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using SEPT7 antibody.
Western blot analysis of extracts of various cell lines, using SEPT7 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT7 antibody.
Western blot analysis of extracts of various cell lines, using SEPT7 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT7 antibody.
Western blot analysis of extracts of various cell lines, using SEPT7 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT7 antibody.
Western blot analysis of extracts of various cell lines, using SEPT7 antibody.

Requested From: United States
Date Requested: 10/23/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy