Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

PTPRF Antibody

PTPRF antibody LS-C490458 is an unconjugated rabbit polyclonal antibody to human PTPRF. Validated for IHC and WB.
100 µg (1 mg/ml)
PTPRF antibody LS-C490458 is an unconjugated rabbit polyclonal antibody to human PTPRF. Validated for IHC and WB.
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
PTPRF antibody was raised against amino acids EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK of human PTPRF were used as the immunogen for the PTPRF antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
P10586 NM_002840 NP_002831.2

Popular PTPRF Products

Species: Human, Mouse, Rat
Applications: ICC, Western blot
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE), At a dilution of 1:100.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, Western blot
Immunohistochemistry image of paraffin-embedded human small intestine tissue at a dilution of 1:100
Species: Human
Applications: IHC, IHC - Paraffin, ELISA

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Western blot

Requested From: United States
Date Requested: 2/15/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy